Basic Vector Information
JN100 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
JN100 vector Sequence
LOCUS 40924_1439 6460 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector JN100, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6460) AUTHORS Nikodinovic J, Priestley ND. TITLE A second generation snp-derived Escherichia coli-Streptomyces shuttle expression vector that is generally transferable by conjugation JOURNAL Plasmid 56 (3), 223-227 (2006) PUBMED 16806469 REFERENCE 2 (bases 1 to 6460) AUTHORS Nikodinovic J, Priestley ND. TITLE Direct Submission JOURNAL Submitted (18-NOV-2005) Chemistry, University of Montana, 32 Campus Dr, Missoula, MT 59812, USA REFERENCE 3 (bases 1 to 6460) TITLE Direct Submission REFERENCE 4 (bases 1 to 6460) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2006"; volume: "56"; issue: "3"; pages: "223-227" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-NOV-2005) Chemistry, University of Montana, 32 Campus Dr, Missoula, MT 59812, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6460 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(191..1561) /codon_start=1 /product="pIJ101 replication protein" /label=pIJ101 replication protein /protein_id="ABC02231.1" /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDAAAVGERVREVLALADAADTVVVLTAG EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH" oriT complement(2656..2765) /direction=LEFT /label=oriT /note="incP origin of transfer" primer_bind 2964..2980 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3035..3799) /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" primer_bind complement(3990..4006) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4014..4030) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4038..4068) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4083..4104) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4392..4980) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5058..5215 /note="multiple cloning site; MCS" regulatory complement(5215..5255) /label=snpA promoter /note="snpA promoter" /regulatory_class="promoter" CDS 5473..6414 /codon_start=1 /gene="snpR" /product="SnpR" /label=snpR /protein_id="ABC02232.1" /translation="MELEVRHLRALCAIADTGSLHRAARQLGVTQPSLSTQLRRIEHEL GGALFVRARTGCRPTPLGRLVLSRARPLVAELRSLVSEARAAAVGGRQLRVGSTASRAL AGWLRRLRRHWQEPTLHMDVSANALLRMVADGHLDVAFVHEVEGSPLRVPEGLRVRVLV QREPQFVCLPADHPAAAKPSYASPTWPTTRWMIDPTVDGEWDAVRRVLRAEGLDPRILH GDYHTAASLVATGEVVTVVQPTSPSRAETAVRRLHGDPLGVRLLLAARTDTELEGVYPD LAEAYGEVARQAPAYREWLERSGSGALVPALP" gene 5473..6414 /gene="snpR" /label=snpR
This page is informational only.