JN100 vector (V009904)

Basic Vector Information

      • Vector Name:
      • JN100
      • Antibiotic Resistance:
      • Apramycin
      • Length:
      • 6460 bp
      • Type:
      • Expression vector
      • Source/Author:
      • Nikodinovic J, Priestley ND.

JN100 vector Vector Map

JN1006460 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300pIJ101 replication proteinfrom RK2 inserted in NdeI restriction site of pANT1202M13 fwdAprRM13 revlac operatorlac promoterCAP binding siteColE1multiple cloning site; MCSsnpA promoterSnpR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

JN100 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6460 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector JN100, complete sequence.
ACCESSION   DQ309424
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6460)
  AUTHORS   Nikodinovic J, Priestley ND.
  TITLE     A second generation snp-derived Escherichia coli-Streptomyces 
            shuttle expression vector that is generally transferable by 
            conjugation
  JOURNAL   Plasmid 56 (3), 223-227 (2006)
  PUBMED    16806469
REFERENCE   2  (bases 1 to 6460)
  AUTHORS   Nikodinovic J, Priestley ND.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-NOV-2005) Chemistry, University of Montana, 32 Campus 
            Dr, Missoula, MT 59812, USA
REFERENCE   3  (bases 1 to 6460)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6460
                     /organism="Expression vector JN100"
                     /mol_type="other DNA"
                     /db_xref="taxon:360401"
     CDS             complement(191..1561)
                     /codon_start=1
                     /product="pIJ101 replication protein"
                     /label=pIJ101 replication protein
                     /protein_id="ABC02231.1"
                     /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE
                     ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG
                     GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG
                     ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA
                     NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS
                     LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG
                     VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDAAAVGERVREVLALADAADTVVVLTAG
                     EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH"
     oriT            2651..2769
                     /note="from RK2 inserted in NdeI restriction site of 
                     pANT1202"
     oriT            2656..2765
                     /note="incP origin of transfer"
     primer_bind     2964..2980
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(2984..3799)
                     /codon_start=1
                     /gene="aprR"
                     /product="AprR"
                     /label=aprR
                     /note="apramycin resistance protein"
                     /protein_id="ABC02230.1"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEGGMRRMRCRSPVDWLSSN"
     gene            complement(2984..3799)
                     /gene="aprR"
                     /label=aprR
     primer_bind     complement(3990..4006)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    4014..4030
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4038..4068)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    4083..4104
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      4389..4519
                     /label=ColE1
                     /note="ColE1"
     rep_origin      complement(4392..4980)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    5058..5215
                     /note="multiple cloning site; MCS"
     regulatory      complement(5215..5255)
                     /regulatory_class="promoter"
                     /note="snpA promoter"
     CDS             5473..6414
                     /codon_start=1
                     /gene="snpR"
                     /product="SnpR"
                     /label=snpR
                     /protein_id="ABC02232.1"
                     /translation="MELEVRHLRALCAIADTGSLHRAARQLGVTQPSLSTQLRRIEHEL
                     GGALFVRARTGCRPTPLGRLVLSRARPLVAELRSLVSEARAAAVGGRQLRVGSTASRAL
                     AGWLRRLRRHWQEPTLHMDVSANALLRMVADGHLDVAFVHEVEGSPLRVPEGLRVRVLV
                     QREPQFVCLPADHPAAAKPSYASPTWPTTRWMIDPTVDGEWDAVRRVLRAEGLDPRILH
                     GDYHTAASLVATGEVVTVVQPTSPSRAETAVRRLHGDPLGVRLLLAARTDTELEGVYPD
                     LAEAYGEVARQAPAYREWLERSGSGALVPALP"
     gene            5473..6414
                     /gene="snpR"
                     /label=snpR

This page is informational only.