Basic Vector Information
- Vector Name:
- JN100
- Antibiotic Resistance:
- Apramycin
- Length:
- 6460 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Nikodinovic J, Priestley ND.
JN100 vector Vector Map
JN100 vector Sequence
LOCUS 40924_1439 6460 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector JN100, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6460) AUTHORS Nikodinovic J, Priestley ND. TITLE A second generation snp-derived Escherichia coli-Streptomyces shuttle expression vector that is generally transferable by conjugation JOURNAL Plasmid 56 (3), 223-227 (2006) PUBMED 16806469 REFERENCE 2 (bases 1 to 6460) AUTHORS Nikodinovic J, Priestley ND. TITLE Direct Submission JOURNAL Submitted (18-NOV-2005) Chemistry, University of Montana, 32 Campus Dr, Missoula, MT 59812, USA REFERENCE 3 (bases 1 to 6460) TITLE Direct Submission REFERENCE 4 (bases 1 to 6460) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2006"; volume: "56"; issue: "3"; pages: "223-227" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-NOV-2005) Chemistry, University of Montana, 32 Campus Dr, Missoula, MT 59812, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6460 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(191..1561) /codon_start=1 /product="pIJ101 replication protein" /label=pIJ101 replication protein /protein_id="ABC02231.1" /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDAAAVGERVREVLALADAADTVVVLTAG EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH" oriT complement(2656..2765) /direction=LEFT /label=oriT /note="incP origin of transfer" primer_bind 2964..2980 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3035..3799) /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" primer_bind complement(3990..4006) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4014..4030) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4038..4068) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4083..4104) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4392..4980) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5058..5215 /note="multiple cloning site; MCS" regulatory complement(5215..5255) /label=snpA promoter /note="snpA promoter" /regulatory_class="promoter" CDS 5473..6414 /codon_start=1 /gene="snpR" /product="SnpR" /label=snpR /protein_id="ABC02232.1" /translation="MELEVRHLRALCAIADTGSLHRAARQLGVTQPSLSTQLRRIEHEL GGALFVRARTGCRPTPLGRLVLSRARPLVAELRSLVSEARAAAVGGRQLRVGSTASRAL AGWLRRLRRHWQEPTLHMDVSANALLRMVADGHLDVAFVHEVEGSPLRVPEGLRVRVLV QREPQFVCLPADHPAAAKPSYASPTWPTTRWMIDPTVDGEWDAVRRVLRAEGLDPRILH GDYHTAASLVATGEVVTVVQPTSPSRAETAVRRLHGDPLGVRLLLAARTDTELEGVYPD LAEAYGEVARQAPAYREWLERSGSGALVPALP" gene 5473..6414 /gene="snpR" /label=snpR
This page is informational only.