HKBS1 vector (V009921)

MSDS

Basic Vector Information

Vector Name:: HKBS1

Antibiotic Resistance:: Tetracycline

Length:: 12538 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Hoang TT, Kutchma AJ, Becher A, Schweizer HP.

HKBS1 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

HKBS1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_1309       12538 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector HKBS1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12538)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     Integration-proficient plasmids for Pseudomonas aeruginosa: 
            site-specific integration and use for engineering of reporter and 
            expression strains
  JOURNAL   Plasmid 43 (1), 59-72 (2000)
  PUBMED    10610820
REFERENCE   2  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Integration-proficient Pseudomonas aeruginosa vectors for isolation 
            of single copy chromosomal lacZ and lux gene fusions
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2000) Microbiology, Colorado State University, 
            Fort Collins, CO 80523, USA
REFERENCE   4  (bases 1 to 12538)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 12538)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2000"; volume: "43"; issue: "1"; pages: "59-72"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (03-APR-2000) Microbiology, Colorado State University, Fort Collins,
            CO 80523, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12538
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    complement(238..285)
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_feature    495..521
                     /note="phage CTX attachment site; core sequence"
     promoter        827..845
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     CDS             complement(1568..2677)
                     /label=LuxE
                     /note="LuxE"
     CDS             complement(2859..3839)
                     /label=LuxB
                     /note="LuxB luciferase subunit"
     CDS             complement(3857..4936)
                     /label=LuxA
                     /note="LuxA luciferase subunit"
     CDS             complement(4988..5908)
                     /label=LuxD
                     /note="LuxD acyltransferase"
     CDS             complement(5923..7362)
                     /label=LuxC
                     /note="LuxC fatty acid reductase"
     misc_feature    7822..7893
                     /label=multiple cloning site
                     /note="multiple cloning site"
     primer_bind     complement(7860..7876)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(7902..7920)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    complement(8094..8141)
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     oriT            complement(8348..8456)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             complement(8615..9784)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /label=int
                     /note="modified integrase"
                     /protein_id="AAG09988.1"
                     /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI
                     INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR
                     PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD
                     GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD
                     LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR
                     DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM
                     LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS"
     gene            complement(8615..9784)
                     /gene="int"
                     /label=int
     rep_origin      complement(9881..10469)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11294..12481)
                     /label=TcR
                     /note="tetracycline efflux protein"

This page is informational only.