NovoPro
Cart 2

HKBS1 vector

Basic Vector Information

Basic Vector Information
Vector Name HKBS1 Antibiotic Resistance Tetracycline
Length 12538 bp Type Cloning vector
Source Hoang TT, Kutchma AJ, Becher A, Schweizer HP.

HKBS1 vector Vector Map

HKBS1 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported               12538 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector HKBS1, complete sequence.
ACCESSION   AF251497
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12538)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     Integration-proficient plasmids for Pseudomonas aeruginosa: 
            site-specific integration and use for engineering of reporter and 
            expression strains
  JOURNAL   Plasmid 43 (1), 59-72 (2000)
  PUBMED    10610820
REFERENCE   2  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Integration-proficient Pseudomonas aeruginosa vectors for isolation 
            of single copy chromosomal lacZ and lux gene fusions
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2000) Microbiology, Colorado State University, 
            Fort Collins, CO 80523, USA
REFERENCE   4  (bases 1 to 12538)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..12538
                     /organism="Cloning vector HKBS1"
                     /mol_type="other DNA"
                     /label=mini-CTX-lacZ
                     /note="mini-CTX-lacZ"
                     /db_xref="taxon:136151"
     protein_bind    238..285
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
     misc_feature    495..521
                     /note="phage CTX attachment site; core sequence"
     regulatory      827..864
                     /regulatory_class="promoter"
                     /note="T3 promoter"
     promoter        827..845
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     CDS             complement(1565..2677)
                     /codon_start=1
                     /gene="luxE"
                     /product="LuxE"
                     /label=luxE
                     /note="component of fatty acid reductase complex"
                     /protein_id="AAG09983.1"
                     /translation="MTSYVDKQEITASSEIDDLIFSSDPLVWSYDEQEKIRKKLVLDAF
                     RNHYKHCREYRHYCQAHKVDDNITEIDDIPVFPTSVFKFTRLLTSQENEIESWFTSSGT
                     NGLKSQVARDRLSIERLLGSVSYGMKYVGSWFDHQIELVNLGPDRFNAHNIWFKYVMSL
                     VELLYPTTFTVTEERIDFVKTLNSLERIKNQGKDLCLIGSPYFIYLLCHYMKDKKISFS
                     GDKSLYIITGGGWKSYEKESLKRDDFNHLLFDTFNLSDISQIRDIFNQVELNTCFFEDE
                     MQRKHVPPWVYARALDPETLKPVPDGTPGLMSYMDASATSYPAFIVTDDVGIISREYGK
                     YPGVLVEILRRVNTRTQKGCALSLTEAFDS"
     gene            complement(1565..2677)
                     /gene="luxE"
                     /label=luxE
     CDS             complement(2856..3839)
                     /codon_start=1
                     /gene="luxB"
                     /product="luciferase"
                     /label=luxB
                     /protein_id="AAG09984.1"
                     /translation="MKFGLFFLNFINSTTVQEQSIVRMQEITEYVDKLNFEQILVYENH
                     FSDNGVVGAPLTVSGFLLGLTEKIKIGSLNHIITTHHPVAIAEEACLLDQLSEGRFILG
                     FSDCEKKDEMHFFNRPVEYQQQLFEECYEIINDALTTGYCNPDNDFYSFPKISVNPHAY
                     TPGGPRKYVTATSHHIVEWAAKKGIPLIFKWDDSNDVRYEYAERYKAVADKYDVDLSEI
                     DHQLMILVNYNEDSNKAKQETRAFISDYVLEMHPNENFENKLEEIIAENAVGNYTECIT
                     AAKLAIEKCGAKSVLLSFEPMNDLMSQKNVINIVDDNIKKYHMEYT"
     gene            complement(2856..3839)
                     /gene="luxB"
                     /label=luxB
     CDS             complement(3854..4936)
                     /codon_start=1
                     /gene="luxA"
                     /product="luciferase"
                     /label=luxA
                     /protein_id="AAG09985.1"
                     /translation="MKFGNFLLTYQPPQFSQTEVMKRLVKLGRISEECGFDTVWLLEHH
                     FTEFGLLGNPYVAAAYLLGATKKLNVGTAAIVLPTAHPVRQLEDVNLLDQMSKGRFRFG
                     ICRGLYNKDFRVFGTDMNNSRALAECWYGLIKNGMTEGYMEADNEHIKFHKVKVNPAAY
                     SRGGAPVYVVAESASTTEWAAQFGLPMILSWIINTNEKKAQLELYNEVAQEYGHDIHNI
                     DHCLSYITSVDHDSIKAKEICRKFLGHWYDSYVNATTIFDDSDQTRGYDFNKGQWRDFV
                     LKGHKDTNRRIDYSYEINPVGTPQECIDIIQKDIDATGISNICCGFEANGTVDEIIASM
                     KLFQSDVMPFLKEKQRSLLY"
     gene            complement(3854..4936)
                     /gene="luxA"
                     /label=luxA
     CDS             complement(4985..5908)
                     /codon_start=1
                     /gene="luxD"
                     /product="acyltransferase"
                     /label=luxD
                     /protein_id="AAG09986.1"
                     /translation="MENESKYKTIDHVICVEGNKKIHVWETLPEENSPKRKNAIIIASG
                     FARRMDHFAGLAEYLSRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVDWLTT
                     RKINNFGMLASSLSARIAYASLSEINASFLITAVGVVNLRYSLERALGFDYLSLPINEL
                     PDNLDFEGHKLGAEVFARDCLDFGWEDLASTINNMMYLDIPFIAFTANNDNWVKQDEVI
                     TLLSNIRSNRCKIYSLLGSSHDLSENLVVLRNFYQSVTKAAIAMDNDHLDIDVDITEPS
                     FEHLTIATVNERRMRIEIENQAISLS"
     gene            complement(4985..5908)
                     /gene="luxD"
                     /label=luxD
     CDS             complement(5920..7362)
                     /codon_start=1
                     /gene="lucC"
                     /product="fatty acid reductase"
                     /label=lucC
                     /protein_id="AAG09987.1"
                     /translation="MTKKISFIINGQVEIFPESDDLVQSINFGDNSVYLPILNDSHVKN
                     IIDCNGNNELRLHNIVNFLYTVGQRWKNEEYSRRRTYIRDLKKYMGYSEEMAKLEANWI
                     SMILCSKGGLYDVVENELGSRHIMDEWLPQDESYVRAFPKGKSVHLLAGNVPLSGIMSI
                     LRAILTKNQCIIKTSSTDPFTANALALSFIDVDPNHPITRSLSVIYWPHQGDTSLAKEI
                     MRHADVIVAWGGPDAINWAVEHAPSYADVIKFGSKKSLCIIDNPVDLTSAATGAAHDVC
                     FYDQRACFSAQNIYYMGNHYEEFKLALIEKLNLYAHILPNAKKDFDEKAAYSLVQKESL
                     FAGLKVEVDIHQRWMIIESNAGVEFNQPLGRCVYLHHVDNIEQILPYVQKNKTQTISIF
                     PWESSFKYRDALALKGAERIVEAGMNNIFRVGGSHDGMRPLQRLVTYISHERPSNYTAK
                     DVAVEIEQTRFLEEDKFLVFVP"
     gene            complement(5920..7362)
                     /gene="lucC"
                     /label=lucC
     misc_feature    7822..7893
                     /label=multiple cloning site
                     /note="multiple cloning site"
     primer_bind     complement(7860..7876)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      7901..7920
                     /regulatory_class="promoter"
                     /note="T7 promoter"
     promoter        complement(7902..7920)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    8094..8141
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
     oriT            8341..8600
     oriT            8348..8456
                     /note="incP origin of transfer"
     CDS             complement(8615..9784)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /label=int
                     /note="modified integrase"
                     /protein_id="AAG09988.1"
                     /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI
                     INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR
                     PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD
                     GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD
                     LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR
                     DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM
                     LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS"
     gene            complement(8615..9784)
                     /gene="int"
                     /label=int
     rep_origin      complement(9881..10469)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11291..12481)
                     /codon_start=1
                     /gene="tet"
                     /product="tetracycline resistance protein"
                     /label=tet
                     /note="modified tet"
                     /protein_id="AAG09989.1"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     gene            complement(11291..12481)
                     /gene="tet"
                     /label=tet
     promoter        complement(12529..19)
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"

This page is informational only.