HKBS1 vector (V009921)

LOCUS       40924_1309       12538 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector HKBS1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12538)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     Integration-proficient plasmids for Pseudomonas aeruginosa: 
            site-specific integration and use for engineering of reporter and 
            expression strains
  JOURNAL   Plasmid 43 (1), 59-72 (2000)
  PUBMED    10610820
REFERENCE   2  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Integration-proficient Pseudomonas aeruginosa vectors for isolation 
            of single copy chromosomal lacZ and lux gene fusions
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 12538)
  AUTHORS   Becher A, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2000) Microbiology, Colorado State University, 
            Fort Collins, CO 80523, USA
REFERENCE   4  (bases 1 to 12538)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 12538)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2000"; volume: "43"; issue: "1"; pages: "59-72"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (03-APR-2000) Microbiology, Colorado State University, Fort Collins,
            CO 80523, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12538
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    complement(238..285)
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_feature    495..521
                     /note="phage CTX attachment site; core sequence"
     promoter        827..845
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     CDS             complement(1568..2677)
                     /label=LuxE
                     /note="LuxE"
     CDS             complement(2859..3839)
                     /label=LuxB
                     /note="LuxB luciferase subunit"
     CDS             complement(3857..4936)
                     /label=LuxA
                     /note="LuxA luciferase subunit"
     CDS             complement(4988..5908)
                     /label=LuxD
                     /note="LuxD acyltransferase"
     CDS             complement(5923..7362)
                     /label=LuxC
                     /note="LuxC fatty acid reductase"
     misc_feature    7822..7893
                     /label=multiple cloning site
                     /note="multiple cloning site"
     primer_bind     complement(7860..7876)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(7902..7920)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    complement(8094..8141)
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     oriT            complement(8348..8456)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             complement(8615..9784)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /label=int
                     /note="modified integrase"
                     /protein_id="AAG09988.1"
                     /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI
                     INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR
                     PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD
                     GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD
                     LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR
                     DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM
                     LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS"
     gene            complement(8615..9784)
                     /gene="int"
                     /label=int
     rep_origin      complement(9881..10469)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11294..12481)
                     /label=TcR
                     /note="tetracycline efflux protein"