CasYFP vector (Cat. No.: V010040)
Basic Information
- Name:
- CasYFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10437 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hahn F, Mantegazza O, Greiner A, Hegemann P, Eisenhut M, Weber AP.
- Promoter:
- T3
CasYFP vector (Cat. No.: V010040) Sequence
LOCUS 40924_435 10437 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector CasYFP, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10437)
AUTHORS Hahn F, Mantegazza O, Greiner A, Hegemann P, Eisenhut M, Weber AP.
TITLE An Efficient Visual Screen for CRISPR/Cas9 Activity in Arabidopsis
thaliana
JOURNAL Front Plant Sci 8, 39 (2017)
PUBMED 28174584
REFERENCE 2 (bases 1 to 10437)
AUTHORS Hahn F, Mantegazza O, Eisenhut M, Greiner A, Hegemann P, Weber APM.
TITLE Direct Submission
JOURNAL Submitted (03-NOV-2016) Plant Biochemistry, Heinrich Heine
University Dusseldorf, Universitatsstr. 1, Dusseldorf 40225, Germany
REFERENCE 3 (bases 1 to 10437)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10437)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Plant
Sci 8, 39 (2017)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(03-NOV-2016) Plant Biochemistry, Heinrich Heine University
Dusseldorf, Universitatsstr. 1, Dusseldorf 40225, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10437
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 4..362
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind complement(385..401)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
misc_RNA complement(785..860)
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
regulatory complement(881..1380)
/label=U6/C8
/note="U6/C8"
/regulatory_class="promoter"
regulatory 1441..2254
/label=from Chlamydomonas reinhardtii
/note="from Chlamydomonas reinhardtii"
/regulatory_class="promoter"
CDS 2273..2293
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
CDS 2291..6394
/label=Cas9
/note="Cas9 (Csn1) endonuclease from the Streptococcus
pyogenes Type II CRISPR/Cas system"
CDS 6401..7114
/label=EYFP
/note="enhanced YFP"
CDS 7130..7186
/codon_start=1
/product="2A peptide from porcine teschovirus-1
polyprotein"
/label=P2A
/note="Eukaryotic ribosomes fail to insert a peptide bond
between the Gly and Pro residues, yielding separate
polypeptides."
/translation="ATNFSLLKQAGDVEENPGP"
CDS 7187..7987
/codon_start=1
/product="aminoglycoside 3'-phosphotransferase VIII"
/function="Selection marker in Chlamydomonas reinhardtii"
/label=aminoglycoside 3'-phosphotransferase VIII
/note="selection marker aminoglycoside
3'-phosphotransferase gene (aph) from Streptomyces rimosus"
/protein_id="AQN67803.1"
/translation="DDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAAL
GAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRLD
VAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGERL
LAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLRE
LAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF"
regulatory 7991..8230
/regulatory_class="terminator"
promoter complement(8249..8267)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(8288..8304)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 8312..8328
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(8336..8366)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(8381..8402)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(8690..9278)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(9452..10309)
/label=AmpR
/note="beta-lactamase"
promoter complement(10310..10414)
/label=AmpR promoter
This page is informational only.