Aqp3a_tVBU1-Strep vector (V010117)

Basic Vector Information

      • Vector Name:
      • Aqp3a_tVBU1-Strep
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 5310 bp
      • Type:
      • Cloning vector
      • Replication origin:
      • ori
      • Source/Author:
      • Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, Nusslein-Volhard C, Irion U.
      • Promoter:
      • CMV

Aqp3a_tVBU1-Strep vector Vector Map

Aqp3a_tVBU1-Strep5310 bp6001200180024003000360042004800CMV enhancerCMV promoterStrep-Tag II8xHisbeta-globin poly(A) signalAmpR promoterAmpRori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

Aqp3a_tVBU1-Strep vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_265        5310 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector Aqp3a_tVBU1-Strep, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5310)
  AUTHORS   Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, 
            Nusslein-Volhard C, Irion U.
  TITLE     Gain-of-function mutations of mau/DrAqp3a influence zebrafish 
            pigment pattern formation through the tissue environment
  JOURNAL   Development (2017) In press
  PUBMED    28506994
REFERENCE   2  (bases 1 to 5310)
  AUTHORS   Eskova A.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for 
            Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 5310)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5310)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Development
            (2017) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-DEC-2016) e-CNV group, Max Planck Institute for Developmental 
            Biology, Spemannstr. 35-39, Tuebingen 72076, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5310
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        42..421
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        422..625
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     CDS             2094..2117
                     /codon_start=1
                     /label=Strep-Tag II
                     /note="peptide that binds Strep-Tactin(R), an engineered 
                     form
                     of streptavidin"
                     /translation="WSHPQFEK"
     CDS             2124..2147
                     /codon_start=1
                     /label=8xHis
                     /note="8xHis affinity tag"
                     /translation="HHHHHHHH"
     polyA_signal    2186..2241
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     promoter        3410..3514
                     /label=AmpR promoter
     CDS             3515..4372
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     rep_origin      4546..5134
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.