Basic Vector Information
- Vector Name:
- pML-EnCMV-FBXL16(1-243aa)-Myc-FLAG-SV40-Neo
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5570 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- SV40
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pML-EnCMV-FBXL16(1-243aa)-Myc-FLAG-SV40-Neo vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pML-EnCMV-FBXL16(1-243aa)-Myc-FLAG-SV40-Neo vector Sequence
LOCUS 62056_17070 5570 bp DNA circular SYN 01-JAN-1980
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5570)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..5570
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 166..182
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
enhancer 343..722
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 723..926
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 952..970
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 1736..1765
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 1784..1807
/codon_start=1
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
/translation="DYKDDDDK"
primer_bind complement(1827..1843)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
polyA_signal 1854..2476
/label=hGH poly(A) signal
/note="human growth hormone polyadenylation signal"
rep_origin complement(2625..3213)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
polyA_signal complement(3542..3589)
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
CDS complement(3824..4615)
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
promoter complement(4650..5007)
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
promoter complement(5009..5113)
/label=AmpR promoter
rep_origin 5140..5570
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
This page is informational only.