pFUSE-mIgG1-Fc2 vector (Cat. No.: V013493)
- Name:
- pFUSE-mIgG1-Fc2
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4187 bp
- Type:
- Protein expression, Antibody expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Zeo
- Promoter:
- EF-1α core
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pFUSE-mIgG1-Fc2 vector (Cat. No.: V013493) Sequence
LOCUS 62056_11030 4187 bp DNA circular SYN 01-JAN-1980
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4187)
AUTHORS .
TITLE Direct Submission
FEATURES Location/Qualifiers
source 1..4187
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 31..242
/label=EF-1-alpha core promoter
/note="core promoter for human elongation factor
EF-1-alpha"
LTR 255..523
/label=5' LTR (truncated)
/note="truncated 5' long terminal repeat (LTR) from human
T-cell leukemia virus (HTLV) type 1"
sig_peptide 573..632
/label=IL-2 signal sequence
/note="human interleukin-2 signal sequence"
polyA_signal complement(1352..1473)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal complement(1577..1971)
/label=beta-globin poly(A)
/note="human beta-globin polyadenylation signal"
CDS complement(1988..2359)
/codon_start=1
/label=BleoR
/note="antibiotic-binding protein"
/translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
EFALRDPAGNCVHFVAEEQD"
enhancer complement(2952..3255)
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
rep_origin complement(3335..3923)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
polyA_signal 4031..4079
/label=poly(A) signal
/note="synthetic polyadenylation signal"
misc_feature 4090..4181
/label=pause site
/note="RNA polymerase II transcriptional pause signal from
the human alpha-2 globin gene"