pPICZαA-SIRT4(25-314) vector (V013276)

MSDS

Basic Vector Information

Vector Name:: pPICZαA-SIRT4(25-314)

Antibiotic Resistance:: Bleomycin

Length:: 4459 bp

Type:: Protein expression

Replication origin:: ori

Host:: Yeast

Selection Marker:: Zeo

Promoter:: AOX1

Growth Strain(s):: DH5a

Growth Temperature:: 37℃

pPICZαA-SIRT4(25-314) vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPICZαA-SIRT4(25-314) vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       62056_18490        4459 bp DNA     circular SYN 01-JAN-1980
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4459)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4459
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        2..940
                     /label=AOX1 promoter
                     /note="inducible promoter, regulated by methanol"
     CDS             941..1207
                     /codon_start=1
                     /label=alpha-factor secretion signal
                     /note="N-terminal secretion signal from S. cerevisiae 
                     alpha-factor"
                     /translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLE
                     GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA"
     CDS             2141..2170
                     /codon_start=1
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
                     /translation="EQKLISEEDL"
     CDS             2186..2203
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     terminator      2283..2529
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     promoter        2544..2955
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        2963..3010
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             3029..3400
                     /codon_start=1
                     /label=BleoR
                     /note="antibiotic-binding protein"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      3469..3716
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(3791..4379)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.