Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V013006 | pCaEXP | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Plasmid pCaEXP is designed to allow genes to be placed under the control of the MET3 promoter and to be integrated into the RP10 locus to take advantage of the increased transformation frequency. The regulated gene is cloned into a BamHI site in front of the MET3 promoter. URA3 was used as a model to demonstrate that it can be used to express conditionally a gene with an essential function.
- Vector Name:
- pCaEXP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6293 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Hyphal fungi
- Source/Author:
- R S Care
- Promoter:
- MET3
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
pCaEXP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Care RS, Trevethick J, Binley KM, Sudbery PE. The MET3 promoter: a new tool for Candida albicans molecular genetics. Mol Microbiol. 1999 Nov;34(4):792-8. doi: 10.1046/j.1365-2958.1999.01641.x. PMID: 10564518.
pCaEXP vector Sequence
LOCUS Exported 6293 bp DNA circular SYN 27-NOV-2024
DEFINITION Exported.
ACCESSION V013006
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6293)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 6293)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6293
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(693..797)
/label=AmpR promoter
misc_feature complement(1081..1929)
/label=RP10
primer_bind 2126..2142
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 2144..3481
/label=MET3 promoter
/note="Candida albicans MET3 promoter"
misc_feature 3523..4877
/label=CaURA3
CDS 3941..4750
/gene="URA3"
/label=Orotidine 5'-phosphate decarboxylase
/note="Orotidine 5'-phosphate decarboxylase from Candida
albicans (strain SC5314 / ATCC MYA-2876). Accession#:
P13649"
primer_bind complement(4898..4914)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4922..4938)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4946..4976)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4991..5012)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5300..5888)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(join(6284..6293,1..692))
/codon_start=1
/label=AmpR
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIAEGG"