Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V012943 | pTf16 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The pTf16 vector plasmid is a chaperone plasmid. Primarily for facilitating the production and folding of recombinant proteins in bacterial systems, particularly Escherichia coli (E. coli). It has been shown that the co-expression of ScFvs and the chaperone plasmids PG-tf2, pTf16, pGro7, pKJE7, and pG-KJE8 leads to a noticeable increase in the expression of soluble proteins.
- Vector Name:
- pTf16
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5014 bp
- Type:
- Packaging assistance
- Replication origin:
- p15A ori
- Host:
- E. coli
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
pTf16 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Nazari A, Farajnia S, Zahri S, Bagherlou N, Tanoumand A, Rahbarnia L. Cytoplasmic Chaperones Enhance Soluble Expression of Anti-EGFR huscFv in Escherichia coli. Iran J Biotechnol. 2020 Apr 1;18(2):e2314. doi: 10.30498/IJB.2020.138200.2314. PMID: 33542937; PMCID: PMC7856399.
pTf16 vector Sequence
LOCUS Exported 5014 bp DNA circular SYN 10-OCT-2024
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5014)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5014)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5014
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(574..1419)
/codon_start=1
/label=AraC
/note="arabinose operon transcriptional regulator AraC"
/translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
"
CDS 1891..3186
/codon_start=1
/label=Trigger Factor
/note="ribosome-associated chaperone from E. coli (Hoffmann
et al., 2010)"
/translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
rep_origin 3622..4167
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 4693..4795
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS join(4796..5014,1..438)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"