pG-Tf2 vector (Cat. No.: V012822)
Note: Plasmid pG-Tf2 could express TF and GroEL-GroES together under the tetracycline-inducible promoter (Pzt-1)
- Name:
- pG-Tf2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8739 bp
- Type:
- E.coli expression plasmid
- Replication origin:
- p15A ori
- Source/Author:
- Takashi Yura
- Copy Number:
- Medium copy number
- Promoter:
- Pzt-1
- 5' Primer:
- GGTAGCTCAGAGAACCTTCG
- 3' Primer:
- gccatctcttcgatcaggc
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Yasamut U, Thongheang K, Weechan A, Sornsuwan K, Juntit OA, Tayapiwatana C. Evaluating the ability of different chaperones in improving soluble expression of a triple-mutated human interferon gamma in Escherichia coli. J Biosci Bioeng. 2024;138(3):232-238. doi:10.1016/j.jbiosc.2024.06.005
pG-Tf2 vector (Cat. No.: V012822) Sequence
LOCUS Exported 8739 bp DNA circular SYN 10-OCT-2024
DEFINITION Exported.
ACCESSION V012822
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8739)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 8739)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 8739)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8739
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 3573..3958
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 4763..4822
/mol_type="other DNA"
/organism="synthetic DNA construct"
RBS 98..109
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 206..259
/label=S loop
/note="GroES chaperone mobile loop that interacts with
GroEL"
CDS 498..2141
/gene="groEL"
/label=Chaperonin GroEL
/note="Chaperonin GroEL from Escherichia coli O8 (strain
IAI1). Accession#: B7M8Q4"
CDS 2202..3497
/label=Trigger Factor
/note="ribosome-associated chaperone from E. coli (Hoffmann
et al., 2010)"
terminator 4833..4919
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
promoter complement(4979..5034)
/label=tetR/tetA promoters
/note="overlapping promoters for bacterial tetR and tetA"
CDS 5050..5673
/label=TetR
/note="tetracycline repressor TetR"
CDS complement(6696..7352)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(7353..7455)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
rep_origin complement(7981..8526)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."