RNAi-Ready pSIREN-RetroQ-ZsGreen1 vector (V012740)

Basic Vector Information

      • Vector Name:
      • RNAi-Ready pSIREN-RetroQ-ZsGreen1
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 6562 bp
      • Type:
      • RNAi
      • Source/Author:
      • Clontech
      • Selection Marker:
      • ZsGreen1
      • Copy Number:
      • Low copy number
      • Promoter:
      • U6
      • Expression Method:
      • Transient

RNAi-Ready pSIREN-RetroQ-ZsGreen1 vector Vector Map

RNAi-Ready pSIREN-RetroQ-ZsGreen16562 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300CMV enhancerCMV promoterZsGreen13' LTR (Delta-U3)SV40 promoteroriAmpRAmpR promoterCMV enhancerCMV promoter5' LTR (truncated)MMLV Psigag (truncated)U6 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

RNAi-Ready pSIREN-RetroQ-ZsGreen1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6562 bp ds-DNA     circular SYN 11-SEP-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6562)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6562
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        66..369
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        370..573
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             618..1313
                     /codon_start=1
                     /product="Zoanthus green fluorescent protein"
                     /note="ZsGreen1"
                     /note="mammalian codon-optimized"
                     /translation="MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAIN
                     LCVVEGGPLPFAEDILSAAFMYGNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAV
                     CICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKG
                     DVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEH
                     AIASGSALP"
     LTR             1433..1858
                     /note="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     Moloney murine leukemia virus"
     promoter        2124..2453
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     rep_origin      2304..2439
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     rep_origin      complement(2746..3334)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3505..4365)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(4366..4470)
                     /gene="bla"
                     /note="AmpR promoter"
     enhancer        4656..5035
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        5036..5239
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     LTR             5240..5415
                     /note="5' LTR (truncated)"
                     /note="truncated long terminal repeat from Moloney murine 
                     sarcoma virus"
     misc_feature    5478..5677
                     /note="MMLV Psi"
                     /note="packaging signal of Moloney murine leukemia virus 
                     (MMLV)"
     CDS             5878..6294
                     /note="gag (truncated)"
                     /note="truncated Moloney murine leukemia virus (MMLV) gag 
                     gene lacking the start codon"
     promoter        6318..6558
                     /note="U6 promoter"
                     /note="RNA polymerase III promoter for human U6 snRNA"

This page is informational only.