pBV220 vector (Cat. No.: V000089)

pBV2203665 bp60012001800240030003600pL promoterrrnB T1 terminatorrrnB T2 terminatorAmpR promoterAmpRorilambda repressor (ts)pR promoter
Basic Information

Note: pBV220 (Cat No.: V000089) is a high-performance E. coli expression vector engineered around the λ phage-derived PL and PR promoters, offering efficient and cost-effective gene expression control through its core features: it is equipped with λPL and λPR promoters that exhibit strong transcriptional initiation capability, regulated by a temperature-sensitive λ repressor (ts) which eliminates the need for chemical inducers, with temperature-dependent regulation where the active repressor inhibits PL/PR promoters at 30℃ and shifting the culture temperature to 42℃ inactivates the repressor to trigger target gene expression; the vector offers cloning and expression advantages such as a multi-cloning site (MCS) downstream of the SD sequence to facilitate insertion of foreign genes with an initiation ATG for expressing non-fusion proteins, and contains strong rrnB T1 and T2 transcription terminators to prevent read-through and enhance system stability.

Name:
pBV220
Antibiotic Resistance:
Ampicillin
Length:
3665 bp
Type:
E. coli Expression Vectors
Replication origin:
ori
Copy Number:
High copy number
Promoter:
pR/pL
Cloning Method:
Enzyme digestion and ligation
5' Primer:
pBV220-F: 5′-AAGAAGGGCAGCATTCAAAG-3‘
3' Primer:
pBV220-R: 5′-CTGCGTTCTGATTTAATCTG-3‘
Growth Strain(s):
DH5a
Growth Temperature:
30℃
$ 199.6
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Ma X, Liang X, Li Y, Feng Q, Cheng K, Ma N, Zhu F, Guo X, Yue Y, Liu G, Zhang T, Liang J, Ren L, Zhao X, Nie G. Modular-designed engineered bacteria for precision tumor immunotherapy via spatiotemporal manipulation by magnetic field. Nat Commun. 2023 Mar 23;14(1):1606.

pBV220 vector (Cat. No.: V000089) Sequence

LOCUS       Exported                3665 bp DNA     circular SYN 30-SEP-2025
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3665)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 3665)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 3665)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3665)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 3665)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3665
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          join(253..3665,1..252)
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        80..130
                     /label=pL promoter
                     /note="lambda PL"
     terminator      490..576
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      668..695
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        714..805
                     /label=AmpR promoter
     CDS             806..1663
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     rep_origin      1837..2425
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2780..3490)
                     /codon_start=1
                     /label=lambda repressor (ts)
                     /note="temperature-sensitive variant of the phage lambda 
                     repressor"
                     /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
                     SGVGALFNGINALNAYNAALLTKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
                     PVFSHVQAGMFSPKLRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD
                     GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
                     VGKVIASQWPEETFG"
     promoter        3531..3580
                     /label=pR promoter
                     /note="lambda PR"