pBBR1MCS-5 vector (Cat. No.: V000069)
Note: Mobilisable shuttle and expression vector, pBBR1MCS series. Vector is mobilisable via RP4/RK2 mating system, e.g. using E.coli strains S17 or SM10. Note: one base pair deletion mutation near C-terminal mob protein
- Name:
- pBBR1MCS-5
- Antibiotic Resistance:
- Gentamicin
- Length:
- 4771 bp
- Type:
- Broad Host Shuttle Vectors
- Replication origin:
- pBBR1 oriV
- Copy Number:
- Low copy number
- Promoter:
- Pc
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Anderson MT, Mitchell LA, Zhao L, Mobley HLT. Citrobacter freundii fitness during bloodstream infection. Sci Rep. 2018 Aug 7;8(1):11792. doi: 10.1038/s41598-018-30196-0.
pBBR1MCS-5 vector (Cat. No.: V000069) Sequence
LOCUS Exported 4771 bp DNA circular SYN 31-AUG-2024
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4771)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4771)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4771)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4771)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4771
/mol_type="other DNA"
/organism="synthetic DNA construct"
source join(229..4771,1..228)
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(24..1027)
/codon_start=1
/product="mob encodes the plasmid mobilization functions
that allow conjugal delivery of the plasmids into a variety
of bacteria from E. coli strains harboring the RK2 conjugal
transfer functions."
/label=mob
/translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLRRC"
promoter complement(1095..1146)
/label=promoter for mob
misc_feature 1106..1128
/label=RSA
/note="transfer origins (also called recombination site A
[RSA]), is known as the specific site necessary for
mobilization and recombination mediated by a Mob/Pre
protein. "
rep_origin 1251..2022
/label=pBBR1 oriV
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
CDS 2023..2682
/codon_start=1
/label=pBBR1 Rep
/note="replication protein for the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica"
/translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
primer_bind 3394..3410
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3420..3438
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 3447..3554
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(3567..3585)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(3606..3622)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3630..3646)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3654..3684)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3699..3720)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 3990..4018
/label=Pc promoter
/note="class 1 integron promoter"
CDS 4207..4737
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"