pTRKH3-ldhGFP vector (V000751)

Price Information

Cat No.	Plasmid Name	Availability	Add to cart
V000751	pTRKH3-ldhGFP	In stock (lyophilized plasmid)	Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

The promoters of L. acidophilus lactate dehydrogenase gene (ldhL) fused to the coding sequence of GFP and inserted into the backbone of the pTRKH3 shuttle vector.

Vector Name:: pTRKH3-ldhGFP

Antibiotic Resistance:: Erythromycin

Length:: 8509 bp

Type:: Lactobacillus expression vectors

Replication origin:: p15A ori

Selection Marker:: mgfp5

Growth Strain(s):: JM108

Growth Temperature:: 37℃

pTRKH3-ldhGFP vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

References

Lizier M, Sarra PG, Cauda R, Lucchini F. Comparison of expression vectors in Lactobacillus reuteri strains. FEMS Microbiol Lett. 2010 Jul 1;308(1):8-15.

pTRKH3-ldhGFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_44286        8509 bp DNA     circular SYN 11-MAR-2024
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8509)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 8509)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8509
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             1322..2056
                     /gene="ermBP"
                     /label=ermBP
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     CDS             3643..5130
                     /codon_start=1
                     /label=repS
                     /note="pLannotate"
                     /note="/database=swissprot"
                     /note="/fragment=False"
                     /note="/identity=97.8"
                     /note="/match_length=100.0"
                     /note="/other=CDS"
                     /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK
                     SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF
                     FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS
                     VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK
                     QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF
                     SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS
                     DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE
                     VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK
                     ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG"
     promoter        complement(5843..5945)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(6471..7016)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        7128..7156
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     CDS             complement(7502..8215)
                     /label=mgfp5
                     /note="GFP with folding enhancement mutations"
     promoter        complement(8223..8507)
                     /label=ldhL promoter
                     /note="L. acidophilus lactate dehydrogenase gene (ldhL) 
                     promoter"