Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V000776 | pTK-Hyg | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pTK-Hyg is a selection vector that confers hygromycin resistance in mammalian cells for the selection of stably transformed cells. pTK-Hyg is especially useful for selection of double-stable cell lines using the Tet-On or Tet-Off Gene Expression Systems because the absence of an enhancer element on pTK-Hyg prevents the unwanted activation of pTRE- and pBI-derived plasmids upon cointegration into the host cell's genome.pTK-Hyg can be cotransfected into the host cell line with an expression plasmid that contains a gene of interest using any standard transfection technique. Most mammalian cell lines require 200 μg/ml of Hygromycin to select for stably transformed cells.
- Vector Name:
- pTK-Hyg
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5066 bp
- Type:
- Tetracycline Regulatory System
- Replication origin:
- ori
- Selection Marker:
- Hyg
- Promoter:
- HSV TK
- Cloning Method:
- Enzyme digestion and ligation
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
pTK-Hyg vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Ren ST, Yu LH, Zhang J, Han SP, Xu CF. Developing a system for regulating expression of human hepatocyte growth factor using tetracycline in NRK52E cells. Urol Int. 2010;85(2):228-236. doi:10.1159/000314956
pTK-Hyg vector Sequence
LOCUS 40924_43503 5066 bp DNA circular SYN 13-JAN-2022
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5066)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5066)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5066
/mol_type="other DNA"
/organism="synthetic DNA construct"
polyA_signal complement(29..163)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal complement(1450..1498)
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
CDS complement(1543..2577)
/codon_start=1
/label=HygR
/note="hygromycin B phosphotransferase"
/translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG
YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP
ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ
TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF
GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG
NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRGDRE
MGEAN"
promoter complement(2612..2757)
/label=HSV TK promoter
/note="herpes simplex virus thymidine kinase promoter"
rep_origin complement(3214..3802)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3976..4833)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(4834..4938)
/label=AmpR promoter