pHT01 vector (Cat. No.: V001452)
Note: pHT01 is a shuttle plasmid designed for cloning and expressing target genes in Streptomyces. Its IPTG-inducible promoter system enables controlled expression of foreign proteins, providing a tool for Streptomyces metabolic engineering and gene function studies.
- Name:
- pHT01
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7953 bp
- Type:
- Bacillus subtilis expression vectors
- Replication origin:
- ori
- Promoter:
- grac
- Growth Strain(s):
- DH10B
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Babar TK, Glare TR, Hampton JG, Hurst MRH, Narciso J, Sheen CR, Koch B. Linocin M18 protein from the insect pathogenic bacterium Brevibacillus laterosporus isolates. Appl Microbiol Biotechnol. 2023 Jul;107(13):4337-4353. doi: 10.1007/s00253-023-12563-8. Epub 2023 May 19. PMID: 37204448; PMCID: PMC10313851.
pHT01 vector (Cat. No.: V001452) Sequence
LOCUS Exported 7953 bp DNA circular SYN 21-JUL-2025
DEFINITION Exported.
ACCESSION V001452
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7953)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 7953)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 7953)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7953)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7953
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(114..761)
/gene="cat"
/label=Chloramphenicol acetyltransferase
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
primer_bind 1236..1252
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(1298..2377)
/label=lacI
/note="lac repressor"
promoter 2681..2800
/label=Pgrac
protein_bind 2761..2785
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
terminator 2830..2855
/label=trp terminator
CDS 2919..3182
/codon_start=1
/label=ParA family protein
/translation="MVETYEANIGLLGIVPVLIKSGGSVDQYILDEARKEFGDDLLNST
IKLRERIKRFDVQGITEEDTHDKEALKLFNNLTMELIERVEG"
CDS 3880..4914
/codon_start=1
/label=helix-turn-helix domain-containing protein
/translation="MSEVNLKGNTDELVYYRQQTTGNKIARKRIKKGKEEVYYVAETEE
KIWTEEQIKNFSLDKFGTHIPYIEGHYTILNNYFFDFWGYFLGAEGIALYAHLTRYAYG
SKDFCFPSLQTIAKKMDKTPVTVRGYLKLLERYGFIWKVNVRNKTKDNTEESPIFKIRR
KVPLLSEELLNGNPNIEIPDDEEAHVKKALKKEKEGLPKVLKKEHDEFVKKMMDESETI
NIPEALQYDTMYEDILSKGEIRKEIKKQIPNPTTSFESISMTTEEEKVDSTLKSEMQNR
VSKPSFDTWFKNTKIKIENKNCLLLVPSEFAFEWIKKRYLETIKTVLEEAGYVFEKIEL
RKVQ"
CDS complement(5290..5796)
/codon_start=1
/label=ORF-2
/translation="MPYSPTLLEGAVSDILLHKKILSPKDLRPEFLSKRFGIEIMTGKT
SYAYIDSDVKVFVLDKKVEEKERNYQFHKLFAHTLLHEENHLEIPMEVYEKHSEEAERL
TWVEAIPYHMLRYIDFSDPEFIKQASDVFYIPEKVVQNRINFMIQQQFEIDEFDNVNEK
VKSFA"
promoter 6030..6134
/label=AmpR promoter
CDS 6135..6992
/label=AmpR
/note="beta-lactamase"
rep_origin 7166..7754
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"