Basic Vector Information
yrbE1AB vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
yrbE1AB vector Sequence
LOCUS 40924_49787 6299 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector yrbE1AB, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6299)
AUTHORS Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.
TITLE Characterization of mycobacterial virulence genes through genetic
interaction mapping
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 103 (31), 11760-11765 (2006)
PUBMED 16868085
REFERENCE 2 (bases 1 to 6299)
AUTHORS Joshi SM, Pandey AK, Capite NM, Fortune SM, Rubin EJ, Sassetti CM.
TITLE Direct Submission
JOURNAL Submitted (26-JUN-2006) Molecular Genetics and Microbiology,
University of Massachusetts Medical School, 55 Lake Ave. North,
Worcester, MA 01655, USA
REFERENCE 3 (bases 1 to 6299)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6299)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2006"; volume: "103"; issue: "31"; pages:
"11760-11765"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(26-JUN-2006) Molecular Genetics and Microbiology, University of
Massachusetts Medical School, 55 Lake Ave. North, Worcester, MA
01655, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6299
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 7..394
/note="promoter from Mycobacterium tuberculosis groEL2
gene"
/regulatory_class="promoter"
CDS 446..1243
/codon_start=1
/gene="yrbE1A"
/product="YrbE1A"
/label=yrbE1A
/protein_id="ABG72765.1"
/translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
gene 446..1243
/gene="yrbE1A"
/label=yrbE1A
CDS 2118..2144
/label=HA
/note="HA (human influenza hemagglutinin) epitope tag"
terminator 2200..2246
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
CDS complement(2298..3293)
/gene="hyg"
/label=hyg
/note="Hygromycin-B 7''-O-kinase from Streptomyces
hygroscopicus. Accession#: P09979"
rep_origin 3632..4220
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
rep_origin 4379..6273
/label=mycobacterial origin of replication from pAL5000
/note="mycobacterial origin of replication from pAL5000"
This page is informational only.