NovoPro
Cart 2

yrbE1AB vector

Basic Vector Information

Basic Vector Information
Vector Name yrbE1AB Antibiotic Resistance Kanamycin
Length 6299 bp Type Expression vector
Source Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.

yrbE1AB vector Vector Map

yrbE1AB vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                6299 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector yrbE1AB, complete sequence.
ACCESSION   DQ823235
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6299)
  AUTHORS   Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.
  TITLE     Characterization of mycobacterial virulence genes through genetic 
            interaction mapping
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 103 (31), 11760-11765 (2006)
  PUBMED    16868085
REFERENCE   2  (bases 1 to 6299)
  AUTHORS   Joshi SM, Pandey AK, Capite NM, Fortune SM, Rubin EJ, Sassetti CM.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2006) Molecular Genetics and Microbiology, 
            University of Massachusetts Medical School, 55 Lake Ave. North, 
            Worcester, MA 01655, USA
REFERENCE   3  (bases 1 to 6299)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..6299
                     /organism="Expression vector yrbE1AB"
                     /mol_type="other DNA"
                     /db_xref="taxon:393139"
     regulatory      7..394
                     /regulatory_class="promoter"
                     /note="promoter from Mycobacterium tuberculosis groEL2 
                     gene"
     CDS             446..1243
                     /codon_start=1
                     /gene="yrbE1A"
                     /product="YrbE1A"
                     /label=yrbE1A
                     /protein_id="ABG72765.1"
                     /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
                     FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
                     TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
                     VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
                     LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
     gene            446..1243
                     /gene="yrbE1A"
                     /label=yrbE1A
     CDS             1245..2147
                     /codon_start=1
                     /gene="yrbE1B-HA"
                     /product="YrbE1B-HA"
                     /label=yrbE1B-HA
                     /note="epitope tagged YrbE1B"
                     /protein_id="ABG72766.1"
                     /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
                     IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
                     VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
                     FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
                     SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
                     DPNFNLTVAAYPYDVPDYA"
     gene            1245..2147
                     /gene="yrbE1B-HA"
                     /label=yrbE1B-HA
     CDS             2118..2144
                     /codon_start=1
                     /product="HA (human influenza hemagglutinin) epitope tag"
                     /label=HA
                     /translation="YPYDVPDYA"
     terminator      2200..2246
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     CDS             complement(2295..3293)
                     /codon_start=1
                     /gene="aph"
                     /product="Aph"
                     /label=aph
                     /note="hygromycin resistance"
                     /protein_id="ABG72767.1"
                     /translation="MTQESLLLLDRIDSDDSYASLRNDQEFWEPLARRALEELGLPVPP
                     VLRVPGESTNPVLVGEPDPVIKLFGEHWCGPESLASESEAYAVLADAPVPVPRLLGRGE
                     LRPGTGAWPWPYLVMSRMTGTTWRSAMDGTTDRNALLALARELGRVLGRLHRVPLTGNT
                     VLTPHSEVFPELLRERRAATVEDHRGWGYLSPRLLDRLEDWLPDVDTLLAGREPRFVHG
                     DLHGTNIFVDLAATEVTGIVDFTDVYAGDSRYSLVQLHLNAFRGDREILAALLDGAQWK
                     RTEDFARELLAFTFLHDFEVFEETPLDLSGFTDPEELAQFLWGPPDTAPGA"
     gene            complement(2295..3293)
                     /gene="aph"
                     /label=aph
     rep_origin      3610..4374
                     /label=replication origin from pUC
                     /note="replication origin from pUC"
     rep_origin      3632..4220
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      4379..6273
                     /label=mycobacterial origin of replication from pAL5000
                     /note="mycobacterial origin of replication from pAL5000"

This page is informational only.