Basic Vector Information
- Vector Name:
- yGALset986
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5586 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Enomoto S, Chen G, Berman J.
- Promoter:
- GAL1,10
yGALset986 vector Map
yGALset986 vector Sequence
LOCUS 40924_49727 5586 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector yGALset986, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5586)
AUTHORS Enomoto S, Chen G, Berman J.
TITLE Vectors for expressing T7 epitope- and His6 affinity-tagged fusion
proteins in S. cerevisiae
JOURNAL BioTechniques 24 (5), 782-786 (1998)
PUBMED 9591127
REFERENCE 2 (bases 1 to 5586)
AUTHORS Enomoto S, Berman J.
TITLE Direct Submission
JOURNAL Submitted (09-JAN-1998) Plant Biology, University of Minnesota, 220
Biological Sciences Center, St. Paul, MN 55108, USA
REFERENCE 3 (bases 1 to 5586)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5586)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"BioTechniques"; date: "1998"; volume: "24"; issue: "5"; pages:
"782-786"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-JAN-1998) Plant Biology, University of Minnesota, 220 Biological
Sciences Center, St. Paul, MN 55108, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5586
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 70..88
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
promoter complement(121..785)
/label=GAL1,10 promoter
/note="divergent inducible promoter, regulated by Gal4"
RBS 804..826
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 846..863
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
CDS 867..899
/codon_start=1
/label=T7 tag (gene 10 leader)
/note="leader peptide from bacteriophage T7 gene 10"
/translation="MASMTGGQQMG"
CDS 903..926
/codon_start=1
/label=Xpress(TM) tag
/note="Xpress(TM) epitope tag, including an enterokinase
recognition and cleavage site"
/translation="DLYDDDDK"
misc_feature 936..982
/label=multiple cloning sites
/note="multiple cloning sites"
terminator 1046..1093
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
rep_origin 1193..1648
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
CDS complement(1912..2568)
/codon_start=1
/label=HIS3
/note="imidazoleglycerol-phosphate dehydratase, required
for histidine biosynthesis"
/translation="MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAE
QATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAF
KEALLARGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFL
ESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM"
promoter complement(2569..2756)
/label=HIS3 promoter
misc_feature complement(3140..3643)
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
promoter 3680..3784
/label=AmpR promoter
CDS 3785..4642
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 4816..5404
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.