NovoPro
Cart 2

yGALset986 vector

Basic Vector Information

Basic Vector Information
Vector Name yGALset986 Antibiotic Resistance Ampicillin
Length 5586 bp Type Cloning vector
Source Enomoto S, Chen G, Berman J.

yGALset986 vector Vector Map

yGALset986 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                5586 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector yGALset986, complete sequence.
ACCESSION   AF041808
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5586)
  AUTHORS   Enomoto S, Chen G, Berman J.
  TITLE     Vectors for expressing T7 epitope- and His6 affinity-tagged fusion 
            proteins in S. cerevisiae
  JOURNAL   BioTechniques 24 (5), 782-786 (1998)
  PUBMED    9591127
REFERENCE   2  (bases 1 to 5586)
  AUTHORS   Enomoto S, Berman J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JAN-1998) Plant Biology, University of Minnesota, 220 
            Biological Sciences Center, St. Paul, MN 55108, USA
REFERENCE   3  (bases 1 to 5586)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..5586
                     /organism="Cloning vector yGALset986"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:71555"
     promoter        70..88
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      112..793
                     /regulatory_class="promoter"
                     /note="S. cerevisiae GAL10 promoter"
     promoter        121..785
                     /gene="GAL1 and GAL10 genes of S. cerevisiae"
                     /label=GAL1,10 promoter
                     /note="divergent inducible promoter, regulated by Gal4"
     protein_bind    452..569
                     /label=UAS
                     /bound_moiety="Gal4"
                     /note="upstream activating sequence mediating 
                     Gal4-dependent induction"
     misc_feature    794..929
                     /label=5' recombination region
                     /note="5' recombination region"
     RBS             804..826
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     misc_feature    846..863
                     /label=polyhistidine affinity tag
                     /note="polyhistidine affinity tag"
     CDS             846..863
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     misc_feature    867..899
                     /label=T7 tag epitope
                     /note="T7 tag epitope"
     CDS             867..899
                     /codon_start=1
                     /product="leader peptide from bacteriophage T7 gene 10"
                     /label=T7 tag (gene 10 leader)
                     /note="promotes efficient translation in E. coli"
                     /translation="MASMTGGQQMG"
     CDS             903..926
                     /codon_start=1
                     /product="Xpress(TM) epitope tag, including an enterokinase
                     recognition and cleavage site"
                     /label=Xpress(TM) tag
                     /translation="DLYDDDDK"
     regulatory      912..926
                     /regulatory_class="other"
                     /note="enterokinase recognition sequence"
     misc_feature    936..982
                     /label=multiple cloning sites
                     /note="multiple cloning sites"
     misc_feature    983..1188
                     /label=3' recombination region
                     /note="3' recombination region"
     terminator      1046..1093
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     rep_origin      1189..1649
                     /label=ori bacteriophage f1
                     /note="ori bacteriophage f1"
     rep_origin      1193..1648
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     gene            complement(1708..2888)
                     /gene="his3"
                     /label=his3
                     /note="S. cerevisiae HIS3"
     CDS             complement(1909..2568)
                     /codon_start=1
                     /gene="S. cerevisiae HIS3"
                     /product="imidazoleglycerol-phosphate dehydratase, required
                     for histidine biosynthesis"
                     /label=HIS3
                     /note="yeast auxotrophic marker"
                     /translation="MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAE
                     QATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAF
                     KEALLARGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFL
                     ESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM"
     promoter        complement(2569..2756)
                     /gene="S. cerevisiae HIS3"
                     /label=HIS3 promoter
     rep_origin      3137..3513
                     /label=S. cerevisiae ARSH4
                     /note="S. cerevisiae ARSH4"
     misc_feature    3140..3643
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN6 centromere fused to an 
                     autonomously replicating sequence"
     gene            3523..3651
                     /gene="cen6"
                     /label=cen6
                     /note="S. cerevisiae CEN6"
     promoter        3680..3784
                     /gene="bla"
                     /label=AmpR promoter
     CDS             3785..4645
                     /codon_start=1
                     /product="beta-lactamase"
                     /label=beta-lactamase
                     /note="ampicillin resistance gene (apr/amp); E. coli 
                     beta-lactamase gene"
                     /protein_id="AAC40223.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      4816..5404
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      5398
                     /label=pUC origin
                     /note="pUC origin"

This page is informational only.