Basic Vector Information
- Vector Name:
- TP-D3cpv
- Antibiotic Resistance:
- Streptomycin
- Length:
- 12953 bp
- Type:
- Binary expression vector
- Replication origin:
- ori
- Source/Author:
- Krebs M, Held K, Binder A, Hashimoto K, Den Herder G, Parniske M, Kudla J, Schumacher K.
- Promoter:
- MAS
TP-D3cpv vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
TP-D3cpv vector Sequence
LOCUS 40924_48962 12953 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary expression vector TP-D3cpv, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12953) AUTHORS Krebs M, Held K, Binder A, Hashimoto K, Den Herder G, Parniske M, Kudla J, Schumacher K. TITLE FRET-based genetically encoded sensors allow high-resolution live cell imaging of Ca(2) dynamics JOURNAL Plant J. 69 (1), 181-192 (2012) PUBMED 21910770 REFERENCE 2 (bases 1 to 12953) AUTHORS Krebs M, Held K, Binder A, Hashimoto K, Den Herder G, Parniske M, Kudla J, Schumacher K. TITLE Direct Submission JOURNAL Submitted (24-OCT-2011) Department of Developmental Biology, Centre for Organismal Studies Heidelberg, Im Neuenheimer Feld 230, Heidelberg 69120, Germany REFERENCE 3 (bases 1 to 12953) TITLE Direct Submission REFERENCE 4 (bases 1 to 12953) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; date: "2012"; volume: "69"; issue: "1"; pages: "181-192" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-OCT-2011) Department of Developmental Biology, Centre for Organismal Studies Heidelberg, Im Neuenheimer Feld 230, Heidelberg 69120, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12953 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(114..138) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" protein_bind 303..324 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 339..369 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 377..393 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 401..417 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 445..1049 /label=AtUBQ10 /note="AtUBQ10" /regulatory_class="promoter" misc_feature 1101..1167 /label=TP anchor, N-terminal peptide of AtCBL2 /note="TP anchor, N-terminal peptide of AtCBL2" CDS 1179..1862 /label=CFP /note="cyan variant of GFP" CDS 2619..3137 /codon_start=1 /product="N-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" /label=VN173 /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIE" terminator 3256..3897 /label=E9 terminator /note="terminator and polyadenylation signal from the pea rbcS-E9 gene" primer_bind complement(3910..3926) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator complement(4508..4760) /label=MAS terminator /note="mannopine synthase terminator" CDS complement(4959..5750) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" promoter complement(5780..6160) /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" misc_feature complement(6532..6556) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 7084..7872 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" rep_origin 8119..8707 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8893..9033) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(9377..9571) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(9640..10704) /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(11141..11767) /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)"
This page is informational only.