Basic Vector Information
- Vector Name:
- Tmp-pSTB205
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6837 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Martinez R.
Tmp-pSTB205 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Tmp-pSTB205 vector Sequence
LOCUS 40924_48952 6837 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector Tmp-pSTB205, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6837) AUTHORS Martinez R. TITLE Cloning challenging DNA sequences: a different approach with linear vectors JOURNAL Unpublished REFERENCE 2 (bases 1 to 6837) AUTHORS Martinez R. TITLE Direct Submission JOURNAL Submitted (19-JUL-2017) Plant Developmental Biology, Max Planck Institute For Plant Breeding Research, Carl-von-Linne Weg 10, Cologne, North Rhine-Westphalia 50829, Germany REFERENCE 3 (bases 1 to 6837) TITLE Direct Submission REFERENCE 4 (bases 1 to 6837) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-JUL-2017) Plant Developmental Biology, Max Planck Institute For Plant Breeding Research, Carl-von-Linne Weg 10, Cologne, North Rhine-Westphalia 50829, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6837 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(73..100) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(192..278) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" protein_bind 331..430 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS complement(831..1133) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(1478..2134) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(2135..2237) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(2383..2482) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 2485..3201 /codon_start=1 /label=Venus /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 5235..6041 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 6187..6775 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.