Tmp-pSTB205 vector (V001589)

Basic Vector Information

      • Vector Name:
      • Tmp-pSTB205
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 6837 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Martinez R.

Tmp-pSTB205 vector Vector Map

Tmp-pSTB2056837 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600rrnB T2rrnB T1attL1CcdBchloramphenicol acetyltransferasecat promoterattM2 adapteropens ORF to stbstbaminoglycoside phosphotransferasepUC origin of replication

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

Tmp-pSTB205 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6837 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector Tmp-pSTB205, complete sequence.
ACCESSION   MF509189
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6837)
  AUTHORS   Martinez R.
  TITLE     Cloning challenging DNA sequences: a different approach with linear 
            vectors
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6837)
  AUTHORS   Martinez R.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUL-2017) Plant Developmental Biology, Max Planck 
            Institute For Plant Breeding Research, Carl-von-Linne Weg 10, 
            Cologne, North Rhine-Westphalia 50829, Germany
REFERENCE   3  (bases 1 to 6837)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6837
                     /organism="Cloning vector Tmp-pSTB205"
                     /mol_type="other DNA"
                     /db_xref="taxon:2026119"
     regulatory      73..100
                     /regulatory_class="other"
                     /note="rrnB T2"
     terminator      73..100
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     regulatory      192..278
                     /regulatory_class="other"
                     /note="rrnB T1"
     terminator      192..278
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     protein_bind    331..430
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    331..404
                     /label=attP1
                     /note="attP1"
     misc_feature    405..432
                     /label=attM1 adapter
                     /note="attM1 adapter"
     CDS             complement(828..1133)
                     /codon_start=1
                     /product="CcdB"
                     /label=CcdB
                     /note="a bacterial toxin that poisons DNA gyrase"
                     /protein_id="AST51818.1"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     CDS             complement(1475..2134)
                     /codon_start=1
                     /product="chloramphenicol acetyltransferase"
                     /function="confers resistance to chloramphenicol"
                     /label=chloramphenicol acetyltransferase
                     /protein_id="AST51819.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(2135..2237)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     misc_feature    2382..2406
                     /label=attM2 adapter
                     /note="attM2 adapter"
     protein_bind    complement(2383..2482)
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    2407..2482
                     /label=attP2
                     /note="attP2"
     misc_feature    join(2413,2483..2484)
                     /label=opens ORF to stb
                     /note="opens ORF to stb"
     misc_feature    2485..5112
                     /label=stb
                     /note="stb"
     CDS             join(2485..3201,3232..3542,3805..3947,4024..4631)
                     /codon_start=1
                     /product="Venus"
                     /label=Venus
                     /protein_id="AST51820.1"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYKELLMCSGQAESGGSSSTESSSLSGGLRFGQKIYFEDGSGSRS
                     KNRVNTVRKSSTTARCQVEGCRMDLSNVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQ
                     CSRFHQLSEFDLEKRSCRRRLACHNERRRKPQPTTALFTSHYSRIAPSLYGNPNAAMIK
                     SVLGDPTAWSTARSVMQRPGPWQINPVRETHPHMNVLSHGSSSFTTCPEMINNNSTDSS
                     CALSLLSNSYPIHQQQLQTPTNTWRPSSGFDSMISFSDKVTMAQPPPISTHQPPISTHQ
                     QYLSQTWEVIAGEKSNSHYMSPVSQISEPADFQISNGTTMGGFELYLHQQVLKQYMEPE
                     NTRAYDSSPQHFNWSL"
     CDS             2485..3201
                     /codon_start=1
                     /product="Venus YFP with monomerizing A206K mutation (Nagai
                     et al., 2002)"
                     /label=mVenus
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     CDS             5235..6044
                     /codon_start=1
                     /product="aminoglycoside phosphotransferase"
                     /function="confers resistance to kanamycin"
                     /label=aminoglycoside phosphotransferase
                     /protein_id="AST51821.1"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      6187..6775
                     /direction=RIGHT
                     /label=pUC origin of replication
                     /note="pUC origin of replication"

This page is informational only.