Basic Vector Information
- Vector Name:
- TKVBL-w+
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7827 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Kondo S, Booker M, Perrimon N.
TKVBL-w+ vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
TKVBL-w+ vector Sequence
LOCUS 40924_48942 7827 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector TKVBL-w+, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7827) AUTHORS Kondo S, Booker M, Perrimon N. TITLE Cross-species RNAi rescue platform in Drosophila melanogaster JOURNAL Genetics 183 (3), 1165-1173 (2009) PUBMED 19720858 REFERENCE 2 (bases 1 to 7827) AUTHORS Kondo S, Booker M, Perrimon N. TITLE Direct Submission JOURNAL Submitted (19-FEB-2009) Department of Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 7827) TITLE Direct Submission REFERENCE 4 (bases 1 to 7827) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; date: "2009"; volume: "183"; issue: "3"; pages: "1165-1173" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-FEB-2009) Department of Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7827 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 1107..1140 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS join(1898..1969,2364..2637,2712..3366,3428..3743,3964..4095, 4166..4780) /codon_start=1 /gene="white" /product="Drosophila white gene eye color pigment" /label=mini-white /note="This is a modified version of the white gene lacking part of the first intron." /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE" CDS complement(5738..6550) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 6674..7309 /label=oriV /note="incP origin of replication" protein_bind 7344..7413 /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" mobile_element complement(7639..7804) /label=Tn7L /note="mini-Tn7 element (left end of the Tn7 transposon)"
This page is informational only.