SW2 vector (V001592)

Basic Vector Information

      • Vector Name:
      • SW2
      • Length:
      • 6451 bp
      • Type:
      • Expression vector
      • Source/Author:
      • Yang XW, Jian HH, Wang FP.

SW2 vector Vector Map

SW26451 bp300600900120015001800210024002700300033003600390042004500480051005400570060006300FpsAFpsBFpsCFpsDChlRcat promoteroriFpsR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

SW2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6451 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector SW2, complete sequence.
ACCESSION   KP979607
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6451)
  AUTHORS   Yang XW, Jian HH, Wang FP.
  TITLE     A novel low temperature-inducible gene expression vector pSW2 based 
            on a filamentous phage of the deep-sea bacterium Shewanella 
            piezotolerans WP3
  JOURNAL   Appl. Environ. Microbiol. (2015) In press
  PUBMED    26048946
REFERENCE   2  (bases 1 to 6451)
  AUTHORS   Yang X-W.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAR-2015) School of Life Sciences and Biotechnology, 
            Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai, 
            Shanghai 200240, China
REFERENCE   3  (bases 1 to 6451)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..6451
                     /organism="Expression vector SW2"
                     /mol_type="other DNA"
                     /note="based on phage SW1 from Sehwanella piezotolerans 
                     WP3"
                     /db_xref="taxon:1670629"
     CDS             622..2247
                     /codon_start=1
                     /product="FpsA"
                     /label=FpsA
                     /note="putative replication protein"
                     /protein_id="AKM49063.1"
                     /translation="MAEGDIKDLAKEKAQQLTKQLATVDDDAERFRLAERSLSFLGLSF
                     DAATVKRKQEAGELFSMVNRAADEYWLRRQLRRRFAQSVEHVARDLALVQKHKQVYCSD
                     FSVNRYRARTEDNRAALENTVAYDEDDASNVFSLAELSDKSVSNVDNRNAEMFIRLKGF
                     EAVSQSLGHSAIFTTVTAPSRFHSVANRVTNKKWLAAGKPTPVQANDYLVEVWTALRKS
                     LDKKKIKIYGMRVVEPHHDGTPHHHQLIFGLPTDLAFVKKELKRLALLDSPNEKGAKEH
                     RFKCEDIDPNYTKKDGSKGSAVGYIAKYISKSTDGKHIEKDLTTDADAAKSAERIVTWA
                     RIENIRQFQFFGGPSVTVWREMRRLKDEIQEGDAVFNNLEGTEHYLLEKVRKSADEGDW
                     AAFCIAMGGVFVKRTDQTVRTHYAVPAVVEKLFESHEYATTRFGDKANARINGILFQGV
                     FKATRFKNWVVMNKEAYIRGQKKVMSGVVDIFDVLEREKEYERMAEQQYQEYENHMFEC
                     EEMQALLFEASAWRGSEATDVMTH"
     CDS             2309..2623
                     /codon_start=1
                     /product="FpsB"
                     /label=FpsB
                     /note="ssDNA binding protein"
                     /protein_id="AKM49064.1"
                     /translation="MKLEGLILDKSDIQTKQKTNFNTGEVNDVGLIKLITTYPTQTVDV
                     HVSVELMKDPKTLQVLNGVVGTRTQLSVEYKEMSFANSDGKHVAINGFHLFELPHVKAS
                     "
     CDS             2761..2946
                     /codon_start=1
                     /product="FpsC"
                     /label=FpsC
                     /note="putative capsid protein"
                     /protein_id="AKM49065.1"
                     /translation="MSRNSEYEARQKSKGLRKVTLWVPCHCENEFRLMAQSCCEDKDLI
                     PFMLRSLSTGQMRKGS"
     CDS             3040..3279
                     /codon_start=1
                     /product="FpsD"
                     /label=FpsD
                     /note="minor capsid protein"
                     /protein_id="AKM49066.1"
                     /translation="MSQCVAFTQEGYLVQSTQSVDDCTGYILVSPTEYNLAIQSIEIDP
                     ADVLQVFGLVFGWVVFLSFISYKVKIAKVLINRV"
     CDS             complement(3483..4142)
                     /codon_start=1
                     /product="ChlR"
                     /label=ChlR
                     /note="chloramphenicol resistance gene"
                     /protein_id="AKM49067.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(4143..4245)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     rep_origin      complement(4315..4903)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6101..6451)
                     /codon_start=1
                     /product="FpsR"
                     /label=FpsR
                     /note="putative replication regulator"
                     /protein_id="AKM49068.1"
                     /translation="MTIGENIKLKRKSLGMTRSELIDRSGVSTAQLSRMERGEQNNPNL
                     ETLVAISTALNTSIDEIVFGEQSTSSIYLSKTIDTLPIDKKTFIKEVIKMAVMISSSEN
                     LENGLKEKKKQG"

This page is informational only.