rpSE937 vector (V001603)

MSDS

Basic Vector Information

Vector Name:: rpSE937

Antibiotic Resistance:: Ampicillin

Length:: 7798 bp

Type:: Cloning vector

Replication origin:: ori

Host:: Yeast

Source/Author:: Elledge SJ, Mulligan JT, Ramer SW, Spottswood M, Davis RW.

Promoter:: GAL1,10

rpSE937 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

rpSE937 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_48713        7798 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector rpSE937, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7798)
  AUTHORS   Elledge SJ, Mulligan JT, Ramer SW, Spottswood M, Davis RW.
  TITLE     Lambda YES: a multifunctional cDNA expression vector for the 
            isolation of genes by complementation of yeast and Escherichia coli 
            mutations
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1731-1735 (1991)
  PUBMED    1848010
REFERENCE   2  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   4  (bases 1 to 7798)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7798)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "1991"; volume: "88"; issue: "5"; pages: 
            "1731-1735"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 1020 East 
            Meadow Circle, Palo Alto, CA 94303, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH. Lambda YES-P and pSE937 are 
            no longer available from CLONTECH and CLONTECH will not update or 
            revise this sequence.
FEATURES             Location/Qualifiers
     source          1..7798
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    complement(66..82)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(90..120)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(135..156)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1390..1610
                     /label=URA3 promoter
     CDS             1611..2411
                     /codon_start=1
                     /label=URA3
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
     misc_feature    complement(3757..4049)
                     /label=CEN4
                     /note="S. cerevisiae CEN4 centromere"
     protein_bind    4093..4126
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     rep_origin      complement(4147..4596)
                     /direction=LEFT
                     /label=ARS1
                     /note="S. cerevisiae autonomously replicating sequence
                     ARS1"
     misc_feature    4736..4876
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(5062..5650)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5824..6681)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(6682..6786)
                     /label=AmpR promoter
     promoter        7042..7706
                     /label=GAL1,10 promoter
                     /note="divergent inducible promoter, regulated by Gal4"

This page is informational only.