Cart 2

rpSE937 vector (V001603#)

Basic Vector Information

Basic Vector Information
Vector Name rpSE937 Antibiotic Resistance Ampicillin
Length 7798 bp Type Cloning vector
Source Elledge SJ, Mulligan JT, Ramer SW, Spottswood M, Davis RW.

rpSE937 vector Vector Map

lac operator lac promoter CAP binding site URA3 promoter URA3 CEN4 loxP bom ori AmpR AmpR promoter GAL1,10 promoter

rpSE937 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                7798 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector rpSE937, complete sequence.
ACCESSION   U02436
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7798)
  AUTHORS   Elledge SJ, Mulligan JT, Ramer SW, Spottswood M, Davis RW.
  TITLE     Lambda YES: a multifunctional cDNA expression vector for the 
            isolation of genes by complementation of yeast and Escherichia coli 
            mutations
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1731-1735 (1991)
  PUBMED    1848010
REFERENCE   2  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   4  (bases 1 to 7798)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH. Lambda YES-P and pSE937 are 
            no longer available from CLONTECH and CLONTECH will not update or 
            revise this sequence.
FEATURES             Location/Qualifiers
     source          1..7798
                     /organism="Cloning vector rpSE937"
                     /mol_type="genomic DNA"
                     /label=plasmid released from lambda YES-P
                     /note="plasmid released from lambda YES-P"
                     /db_xref="taxon:31859"
     protein_bind    66..82
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(90..120)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    135..156
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        1395..1610
                     /gene="S. cerevisiae URA3"
                     /label=URA3 promoter
     CDS             1611..2414
                     /codon_start=1
                     /gene="S. cerevisiae URA3"
                     /product="orotidine-5'-phosphate decarboxylase, required 
                     for uracil biosynthesis"
                     /label=URA3
                     /note="yeast auxotrophic marker, counterselectable with 
                     5-fluoroorotic acid (5-FOA)"
                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
     misc_feature    3757..4049
                     /label=CEN4
                     /note="S. cerevisiae CEN4 centromere"
     protein_bind    complement(4093..4126)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     misc_feature    4736..4876
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(5062..5650)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5821..6681)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(6682..6786)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        7042..7706
                     /gene="GAL1 and GAL10 genes of S. cerevisiae"
                     /label=GAL1,10 promoter
                     /note="divergent inducible promoter, regulated by Gal4"
     protein_bind    7258..7375
                     /label=UAS
                     /bound_moiety="Gal4"
                     /note="upstream activating sequence mediating 
                     Gal4-dependent induction"

This page is informational only.