rpSE937 vector (V001603)

LOCUS       40924_48713        7798 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector rpSE937, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7798)
  AUTHORS   Elledge SJ, Mulligan JT, Ramer SW, Spottswood M, Davis RW.
  TITLE     Lambda YES: a multifunctional cDNA expression vector for the 
            isolation of genes by complementation of yeast and Escherichia coli 
            mutations
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (5), 1731-1735 (1991)
  PUBMED    1848010
REFERENCE   2  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7798)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   4  (bases 1 to 7798)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7798)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "1991"; volume: "88"; issue: "5"; pages: 
            "1731-1735"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 1020 East 
            Meadow Circle, Palo Alto, CA 94303, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH. Lambda YES-P and pSE937 are 
            no longer available from CLONTECH and CLONTECH will not update or 
            revise this sequence.
FEATURES             Location/Qualifiers
     source          1..7798
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    complement(66..82)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(90..120)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(135..156)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1390..1610
                     /label=URA3 promoter
     CDS             1611..2411
                     /codon_start=1
                     /label=URA3
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
     misc_feature    complement(3757..4049)
                     /label=CEN4
                     /note="S. cerevisiae CEN4 centromere"
     protein_bind    4093..4126
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     rep_origin      complement(4147..4596)
                     /direction=LEFT
                     /label=ARS1
                     /note="S. cerevisiae autonomously replicating sequence
                     ARS1"
     misc_feature    4736..4876
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(5062..5650)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5824..6681)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(6682..6786)
                     /label=AmpR promoter
     promoter        7042..7706
                     /label=GAL1,10 promoter
                     /note="divergent inducible promoter, regulated by Gal4"