pDEST32 vector (Cat. No.: V001687)
Note: pDEST32 is used for the Yeast two hybrid system.
- Name:
- pDEST32
- Antibiotic Resistance:
- Gentamicin
- Length:
- 12293 bp
- Type:
- Yeast Two-Hybrid System Vectors
- Replication origin:
- ori
- Host:
- Yeast
- Copy Number:
- High copy number
- Promoter:
- ADH1(long)
- Growth Strain(s):
- DB3.1
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Rajagopala SV, Hughes KT, Uetz P. Benchmarking yeast two-hybrid systems using the interactions of bacterial motility proteins. Proteomics. 2009 Dec;9(23):5296-302.
- Reece-Hoyes JS, Walhout AJM. Generating Yeast Two-Hybrid Bait Strains. Cold Spring Harb Protoc. 2018 Jul 2;2018(7).
pDEST32 vector (Cat. No.: V001687) Sequence
LOCUS pDEST32 12293 bp DNA circular SYN 26-DEC-2025
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12293)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 12293)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12293
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 849..1553
/gene="S. cerevisiae ADH1"
/label=S. cerevisiae ADH1 promoter
/note="ADH1 promoter"
/note="promoter for alcohol dehydrogenase 1"
CDS 1581..2021
/codon_start=1
/gene="Saccharomyces cerevisiae GAL4 (truncated)"
/product="DNA binding domain of the GAL4 transcriptional
activator"
/label=Saccharomyces cerevisiae GAL4 (truncated)
/note="GAL4 DNA binding domain"
/translation="MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTK
RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK
DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS"
protein_bind 2037..2161
/gene="mutant version of attR"
/label=LR Clonase(TM) binding site
/bound_moiety="LR Clonase(TM)"
/note="attR1"
/note="recombination site for the Gateway(R) LR reaction"
promoter 2335..2437
/note="cat promoter"
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 2438..3118
/codon_start=1
/product="chloramphenicol acetyltransferase"
/label=chloramphenicol acetyltransferase
/note="CmR"
/note="confers resistance to chloramphenicol"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQAGRNLE
DPAY"
CDS 3438..3743
/codon_start=1
/gene="ccdB"
/product="CcdB, a bacterial toxin that poisons DNA gyrase"
/label=ccdB
/note="ccdB"
/note="Plasmids containing the ccdB gene cannot be
propagated in standard E. coli strains."
/translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
VPRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
protein_bind complement(3784..3908)
/gene="mutant version of attR"
/label=LR Clonase(TM) binding site
/bound_moiety="LR Clonase(TM)"
/note="attR2"
/note="recombination site for the Gateway(R) LR reaction"
terminator 4108..4295
/gene="S. cerevisiae ADH1"
/label=S. cerevisiae ADH1 terminator
/note="ADH1 terminator"
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
promoter complement(4448..4466)
/note="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(4473..4489)
/label=M13 fwd
/note="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 4630..5085
/direction=RIGHT
/label=f1 ori
/note="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 5386..5793
/gene="S. cerevisiae LEU2"
/label=S. cerevisiae LEU2 promoter
/note="LEU2 promoter"
CDS 5794..6888
/codon_start=1
/gene="S. cerevisiae LEU2"
/product="3-isopropylmalate dehydrogenase, required for
leucine biosynthesis"
/label=S. cerevisiae LEU2
/note="LEU2"
/note="yeast auxotrophic marker"
/translation="MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHL
IGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA
NLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYT
VPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQ
LIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAF
GLYEPCHGSAPDLPKNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG
DLGGSNSTTEVGDAVAEEVKKILA"
misc_feature 7621..8124
/label=CEN/ARS
/note="CEN/ARS"
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
CDS complement(8479..9012)
/codon_start=1
/gene="aacC1"
/product="gentamycin acetyltransferase"
/label=aacC1
/note="GmR"
/note="confers resistance to gentamycin"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
promoter complement(9201..9229)
/gene="intI1 (promoter lies within the coding sequence)"
/label=intI1 (promoter lies within the coding sequence
/note="Pc promoter"
/note="class 1 integron promoter"
rep_origin 9886..10474
/direction=RIGHT
/label=ori
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 10762..10783
/label=E. coli catabolite activator protein binding site
/bound_moiety="E. coli catabolite activator protein"
/note="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 10798..10828
/note="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 10836..10852
/label=lac repressor encoded by lacI binding site
/bound_moiety="lac repressor encoded by lacI"
/note="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 10860..10876
/label=M13 rev
/note="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
promoter 10897..10915
/note="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
terminator complement(10945..11192)
/gene="S. cerevisiae CYC1"
/label=S. cerevisiae CYC1 terminator
/note="CYC1 terminator"
/note="transcription terminator for CYC1"