Cart 2

PZPnat1 vector (V001828#)

Basic Vector Information

Basic Vector Information
Vector Name PZPnat1 Antibiotic Resistance Kanamycin
Length 8489 bp Type Cloning vector
Source Gardiner DM, Howlett BJ.

PZPnat1 vector Vector Map

right border repeat M13 fwd SK primer TrpC NatR TrpC M13 rev lac operator lac promoter CAP binding site left border repeat KanR ori bom pVS1 oriV pVS1 RepA STA region from pVS1

PZPnat1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                8489 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector PZPnat1, complete sequence.
ACCESSION   AY631958
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8489)
  AUTHORS   Gardiner DM, Howlett BJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2004) School of Botany, The University of 
            Melbourne, Melbourne, VIC 3010, Australia
REFERENCE   2  (bases 1 to 8489)
  AUTHORS   Gardiner DM, Howlett BJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2014) School of Botany, The University of 
            Melbourne, Melbourne, VIC 3010, Australia
REFERENCE   3  (bases 1 to 8489)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     On Mar 13, 2014 this sequence version replaced AY631958.1.
FEATURES             Location/Qualifiers
     source          1..8489
                     /organism="Cloning vector PZPnat1"
                     /mol_type="other DNA"
                     /db_xref="taxon:282076"
     repeat_region   94..119
                     /label=right border repeat
                     /note="right border repeat"
     misc_feature    114..138
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     primer_bind     334..350
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     380..396
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      440..801
                     /regulatory_class="promoter"
                     /note="TrpC"
     CDS             818..1387
                     /codon_start=1
                     /product="nourseothricin acetyl transferase"
                     /label=nourseothricin acetyl transferase
                     /note="NatR"
                     /protein_id="AAT51694.2"
                     /translation="MTTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFT
                     LREVPVDPPLTKVFPDDESDDESDDGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRR
                     LTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTL
                     CGLDTALYDGTASDGEQALYMSMPCP"
     regulatory      1398..2115
                     /regulatory_class="terminator"
                     /note="TrpC"
     primer_bind     complement(2137..2153)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    2161..2177
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2185..2215)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2230..2251
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     repeat_region   2427..2452
                     /label=left border repeat
                     /note="left border repeat"
     misc_feature    2428..2452
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             2745..3560
                     /codon_start=1
                     /product="aminoglycoside phosphotransferase"
                     /label=aminoglycoside phosphotransferase
                     /note="KanR"
                     /protein_id="AAT51695.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      3655..4243
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      3859..4139
                     /label=pBR322
                     /note="pBR322"
     misc_feature    4429..4569
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      4913..5107
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
     rep_origin      4949..5949
                     /label=pVS1
                     /note="pVS1"
     CDS             complement(5173..6240)
                     /codon_start=1
                     /product="replication protein from the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
                     /label=pVS1 RepA
                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA
                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR
                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR
                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL
                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA
                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV
                     MRYRNLIEGEASAGS"
     misc_feature    6542..7542
                     /label=STA region from pVS1
                     /note="STA region from pVS1"
     CDS             complement(6674..7303)
                     /codon_start=1
                     /product="stability protein from the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
                     /label=pVS1 StaA
                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR
                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP
                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI
                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

This page is informational only.