Cart 2

pyEF1A vector (V001900#)

Basic Vector Information

Basic Vector Information
Vector Name pyEF1A Antibiotic Resistance Chloramphenicol
Length 5324 bp Type RpL23-fusion expression vector
Source Sorensen HP, Kristensen JE, Sperling-Petersen HU, Mortensen KK.

pyEF1A vector Vector Map

Cat cat promoter p15A ori transcriptional regulator AraC RBS rpL23-yEF1A fusion protein

pyEF1A vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5324 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  RpL23-fusion expression vector pyEF1A, complete sequence.
ACCESSION   AY584597
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5324)
  AUTHORS   Sorensen HP, Kristensen JE, Sperling-Petersen HU, Mortensen KK.
  TITLE     Soluble expression of aggregating proteins by covalent coupling to 
            the ribosome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5324)
  AUTHORS   Sorensen HP, Sperling-Petersen HU, Mortensen KK.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2004) Department of Molecular Biology, Aarhus 
            University, Gustav Wieds Vej 10C, Aarhus C 8000, Denmark
REFERENCE   3  (bases 1 to 5324)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5324
                     /organism="rpL23-fusion expression vector pyEF1A"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /label=pBAD derivative
                     /note="pBAD derivative"
                     /db_xref="taxon:272702"
     CDS             complement(75..734)
                     /codon_start=1
                     /product="chloramphenicol acetyl transferase"
                     /label=chloramphenicol acetyl transferase
                     /note="Cat"
                     /protein_id="AAT01103.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(735..837)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     rep_origin      complement(1363..1907)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(2046..2975)
                     /codon_start=1
                     /product="transcriptional regulator AraC"
                     /label=transcriptional regulator AraC
                     /protein_id="AAT01104.1"
                     /translation="MQYGQLVSSLNGGSMKSMAEAQNDPLLPGYSFNAHLVAGLTPIEA
                     NGYLDFFIDRPLGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPE
                     AREWYHQWVYFRPRAYWHEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGR
                     YSELLAINLLEQLLLRRMEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVC
                     LSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRV
                     FKKCTGASPSEFRAGCEEKVNDVAVKLS"
     CDS             complement(2046..2924)
                     /codon_start=1
                     /gene="araC"
                     /product="L-arabinose regulatory protein"
                     /label=araC
                     /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
                     ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
                     HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
                     MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
                     VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
                     EKVNDVAVKLS"
     promoter        2951..3235
                     /gene="araBAD"
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the 
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     RBS             3262..3284
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     CDS             3292..5022
                     /codon_start=1
                     /product="rpL23-yEF1A fusion protein"
                     /label=rpL23-yEF1A fusion protein
                     /note="ribosomal protein L23 fused to yeast elongation 
                     factor 1A"
                     /protein_id="AAT01102.1"
                     /translation="MIREERLLKVLRAPHVSEKASTAMEKSNTIVLKVAKDATKAEIKA
                     AVQKLFEVEVEVVNTLVVKGKVKRHGQRIGRRSDWKKAYVTLKEGQNLDFVGGAEIEGR
                     ENLYFQGAMGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGK
                     GSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQAD
                     CAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIV
                     KETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLE
                     AIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEV
                     KSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLN
                     HPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPS
                     KPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTEKAAKVTKAAQKAAKKHHHHHH
                     "
     CDS             3592..3603
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     CDS             3604..3624
                     /codon_start=1
                     /product="tobacco etch virus (TEV) protease recognition and
                     cleavage site"
                     /label=TEV site
                     /translation="ENLYFQG"
     CDS             5002..5019
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"

This page is informational only.