pX6-GFP vector (V002056)

LOCUS       40924_47053       14103 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Plant DNA excision vector pX6-GFP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14103)
  AUTHORS   Zuo J, Niu QW, Moller SG, Chua NH.
  TITLE     Chemical-regulated, site-specific DNA excision in transgenic plants
  JOURNAL   Nat. Biotechnol. 19 (2), 157-161 (2001)
  PUBMED    11175731
REFERENCE   2  (bases 1 to 14103)
  AUTHORS   Zuo J, Chua N-H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2000) Laboratory of Plant Molecular Biology, The 
            Rockefeller University, 1230 York Avenue, New York, NY 10021, USA
REFERENCE   3  (bases 1 to 14103)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 14103)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat. 
            Biotechnol."; date: "2001"; volume: "19"; issue: "2"; pages: 
            "157-161"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-DEC-2000) Laboratory of Plant Molecular Biology, The Rockefeller
            University, 1230 York Avenue, New York, NY 10021, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..14103
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(1..25)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     promoter        216..262
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     protein_bind    complement(280..313)
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     CDS             332..583
                     /label=LexA BD
                     /note="DNA-binding domain of E. coli LexA"
     CDS             599..832
                     /label=VP16 AD
                     /note="transcriptional activation domain of herpes simplex
                     virus protein VP16 (Triezenberg et al., 1988; Cousens et 
                     al., 1989)"
     CDS             842..1777
                     /label=ERT2
                     /note="mutated ligand-binding domain of the human estrogen 
                     receptor (Feil et al., 1997)"
     3'UTR           1797..1890
                     /label=rat glucocorticoid receptor
                     /note="rat glucocorticoid receptor"
     regulatory      1916..2211
                     /label=pea rbcS E9
                     /note="pea rbcS E9"
                     /regulatory_class="terminator"
     promoter        2368..2551
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             2575..3363
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase from Tn5"
     misc_feature    3368..3739
                     /label=derived from pBI101
                     /note="derived from pBI101"
     terminator      3756..4008
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    4099..4249
                     /label=LexA operator
                     /note="LexA operator"
     regulatory      4329..4387
                     /label=35S promoter
                     /note="35S promoter"
                     /regulatory_class="promoter"
     promoter        4331..4377
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     5'UTR           4390..4408
                     /label=cre
                     /note="cre"
     CDS             join(4409..4840,5011..5610)
                     /codon_start=1
                     /product="cre"
                     /label=cre
                     /protein_id="AAK08508.1"
                     /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML
                     LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL
                     PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF
                     LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE
                     RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ
                     RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE
                     DGD"
     intron          4841..5010
                     /number=5
                     /note="Arabidopsis KOR1 gene"
     3'UTR           5611..5620
                     /label=cre
                     /note="cre"
     regulatory      5624..6036
                     /label=Nos
                     /note="Nos"
                     /regulatory_class="terminator"
     terminator      5788..6040
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     protein_bind    complement(6041..6074)
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     CDS             6101..6814
                     /label=GFP (S65T)
                     /note="S65T variant of Aequorea victoria green fluorescent 
                     protein (Heim et al., 1995)"
     regulatory      6830..7299
                     /label=3A
                     /note="3A"
                     /regulatory_class="terminator"
     misc_feature    7305..7505
                     /label=derived from pUC9
                     /note="derived from pUC9"
     primer_bind     complement(7331..7347)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    7506..7562
                     /label=derived from pBI101
                     /note="derived from pBI101"
     misc_feature    complement(7569..7593)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             8121..8909
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      9156..9744
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(9930..10070)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(10414..10608)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(10677..11741)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(12178..12804)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"