pVZ326 vector (V002218)

LOCUS       40924_46148        9231 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVZ326, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9231)
  AUTHORS   Obando ST, Babykin MM, Zinchenko VV.
  TITLE     A Cluster of Five Genes Essential for the Utilization of 
            Dihydroxamate Xenosiderophores in Synechocystis sp. PCC 6803
  JOURNAL   Curr. Microbiol. (2018) In press
  PUBMED    29785634
REFERENCE   2  (bases 1 to 9231)
  AUTHORS   Obando TSA., Babykin MM, Zinchenko VV.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-OCT-2017) Dept. of Genetics, Moscow State University, 
            Moscow 119991, Russian Federation
REFERENCE   3  (bases 1 to 9231)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9231)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Curr. 
            Microbiol. (2018) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (30-OCT-2017) Dept. of Genetics, Moscow State University, Moscow 
            119991, Russian Federation"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9231
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(425..1237)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_difference 1239..1240
                     /replace="ac"
                     /compare="AF100176.1"
                     /note="creates NdeI site overlapping the ATG start codon of
                     aphA gene"
     rep_origin      complement(2095..2489)
                     /direction=LEFT
                     /label=RSF1010 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     RSF1010; requires the RSF1010 RepA/B/C proteins for 
                     replication (Scholz et al., 1989)"
     CDS             complement(2516..2800)
                     /codon_start=1
                     /gene="mobC"
                     /product="mobilization protein C"
                     /label=mobC
                     /protein_id="AWZ62436.1"
                     /translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK
                     VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
     gene            complement(2516..2800)
                     /gene="mobC"
                     /label=mobC
     oriT            2831..2918
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             3747..4160
                     /codon_start=1
                     /gene="mobB"
                     /product="mobilization protein B"
                     /label=mobB
                     /protein_id="AWZ62438.1"
                     /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS
                     EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
                     MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
     gene            3747..4160
                     /gene="mobB"
                     /label=mobB
     CDS             4157..5125
                     /label=RSF1010 RepB
                     /note="replication protein B of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             5189..5401
                     /codon_start=1
                     /product="protein E"
                     /label=protein E
                     /protein_id="AWZ62440.1"
                     /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
                     LNLDGCTLSLFREDKPFGPGKFLGD"
     CDS             5403..5609
                     /codon_start=1
                     /gene="cac"
                     /product="repressor protein F"
                     /label=cac
                     /protein_id="AWZ62441.1"
                     /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
                     EALRECLEELRAAQGGGSDPASA"
     gene            5403..5609
                     /gene="cac"
                     /label=cac
     CDS             5639..6475
                     /label=RSF1010 RepA
                     /note="replication protein A of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     CDS             6465..7313
                     /label=RSF1010 RepC
                     /note="replication protein C of the broad-host-range
                     plasmid RSF1010 (Scholz et al., 1989)"
     promoter        complement(8064..8168)
                     /label=AmpR promoter
     promoter        8371..8473
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             8474..9130
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"