Basic Vector Information
- Vector Name:
- pVZ326
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9231 bp
- Type:
- Cloning vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Obando ST, Babykin MM, Zinchenko VV.
pVZ326 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVZ326 vector Sequence
LOCUS 40924_46148 9231 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pVZ326, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9231)
AUTHORS Obando ST, Babykin MM, Zinchenko VV.
TITLE A Cluster of Five Genes Essential for the Utilization of
Dihydroxamate Xenosiderophores in Synechocystis sp. PCC 6803
JOURNAL Curr. Microbiol. (2018) In press
PUBMED 29785634
REFERENCE 2 (bases 1 to 9231)
AUTHORS Obando TSA., Babykin MM, Zinchenko VV.
TITLE Direct Submission
JOURNAL Submitted (30-OCT-2017) Dept. of Genetics, Moscow State University,
Moscow 119991, Russian Federation
REFERENCE 3 (bases 1 to 9231)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9231)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr.
Microbiol. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-OCT-2017) Dept. of Genetics, Moscow State University, Moscow
119991, Russian Federation"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9231
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(425..1237)
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_difference 1239..1240
/replace="ac"
/compare="AF100176.1"
/note="creates NdeI site overlapping the ATG start codon of
aphA gene"
rep_origin complement(2095..2489)
/direction=LEFT
/label=RSF1010 oriV
/note="replication origin of the broad-host-range plasmid
RSF1010; requires the RSF1010 RepA/B/C proteins for
replication (Scholz et al., 1989)"
CDS complement(2516..2800)
/codon_start=1
/gene="mobC"
/product="mobilization protein C"
/label=mobC
/protein_id="AWZ62436.1"
/translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK
VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
gene complement(2516..2800)
/gene="mobC"
/label=mobC
oriT 2831..2918
/label=RSF1010 oriT
/note="origin of transfer of the broad-host-range plasmid
RSF1010 (Scholz et al., 1989)"
CDS 3747..4160
/codon_start=1
/gene="mobB"
/product="mobilization protein B"
/label=mobB
/protein_id="AWZ62438.1"
/translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS
EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
gene 3747..4160
/gene="mobB"
/label=mobB
CDS 4157..5125
/label=RSF1010 RepB
/note="replication protein B of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 5189..5401
/codon_start=1
/product="protein E"
/label=protein E
/protein_id="AWZ62440.1"
/translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
LNLDGCTLSLFREDKPFGPGKFLGD"
CDS 5403..5609
/codon_start=1
/gene="cac"
/product="repressor protein F"
/label=cac
/protein_id="AWZ62441.1"
/translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
EALRECLEELRAAQGGGSDPASA"
gene 5403..5609
/gene="cac"
/label=cac
CDS 5639..6475
/label=RSF1010 RepA
/note="replication protein A of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 6465..7313
/label=RSF1010 RepC
/note="replication protein C of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
promoter complement(8064..8168)
/label=AmpR promoter
promoter 8371..8473
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 8474..9130
/label=CmR
/note="chloramphenicol acetyltransferase"
This page is informational only.