Basic Vector Information
- Vector Name:
- pVZ-CAM.fa
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5080 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Fraga D, Keenan E, Hendel E, Nair A, Schofield W.
pVZ-CAM.fa vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVZ-CAM.fa vector Sequence
LOCUS 40924_46143 5080 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pVZ-CAM.fa, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5080)
AUTHORS Fraga D, Keenan E, Hendel E, Nair A, Schofield W.
TITLE The particle inflow gun can be used to co-transform Paramecium using
Tungsten particles
JOURNAL J. Eukaryot. Microbiol. 53 (1), 16-19 (2006)
PUBMED 16441576
REFERENCE 2 (bases 1 to 5080)
AUTHORS Fraga D.
TITLE Direct Submission
JOURNAL Submitted (05-MAY-2004) Biology, College of Wooster, 931 College
Mall, Wooster, OH 44691, USA
REFERENCE 3 (bases 1 to 5080)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5080)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J.
Eukaryot. Microbiol."; date: "2006"; volume: "53"; issue: "1";
pages: "16-19"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(05-MAY-2004) Biology, College of Wooster, 931 College Mall,
Wooster, OH 44691, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5080
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 930..2779
/mol_type="other DNA"
/db_xref="taxon:5888"
/organism="Paramecium tetraurelia"
rep_origin complement(237..692)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 837..853
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 860..878
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS complement(1557..2006)
/codon_start=1
/product="calmodulin"
/label=calmodulin
/protein_id="AAT38517.1"
/translation="MAE*LTEE*IAEFKEAFALFDKDGDGTITTKELGTVMRSLG*NPT
EAELQDMINEVDADGNGTIDFPEFLSLMARKMKE*DSEEELIEAFKVFDRDGNGLISAA
ELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK"
promoter complement(2820..2838)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(2859..2875)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2883..2899)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2907..2937)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2952..2973)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(3261..3849)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4023..4880)
/label=AmpR
/note="beta-lactamase"
promoter complement(4881..4985)
/label=AmpR promoter
This page is informational only.