NovoPro
Cart 2

pVWEx1 vector

Basic Vector Information

Basic Vector Information
Vector Name pVWEx1 Length 8619 bp
Type Cloning vector Source Bekel T, Stadermann KB, Voss M.

pVWEx1 vector Vector Map

pVWEx1 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                8619 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVWEx1, complete sequence.
ACCESSION   MF034723
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8619)
  AUTHORS   Bekel T, Stadermann KB, Voss M.
  TITLE     Nucleotide sequence analysis of the plasmid pVWEx1 by Illumina 
            sequencing technology
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8619)
  AUTHORS   Bekel T, Stadermann KB, Voss M.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-APR-2017) Evonik Nutrition & Care GmbH, Kantstrasse 2,
            Halle 33790, Germany
REFERENCE   3  (bases 1 to 8619)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 9
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8619
                     /organism="Cloning vector pVWEx1"
                     /mol_type="other DNA"
                     /label=derived from Corynebacterium glutamicum
                     /note="derived from Corynebacterium glutamicum"
                     /db_xref="taxon:2005483"
     regulatory      1..80
                     /regulatory_class="promoter"
                     /note="tacI"
     promoter        7..35
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and 
                     lac UV5 promoters"
     protein_bind    43..59
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    105..161
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     misc_feature    117..140
                     /label=multiple cloning site
                     /note="multiple cloning site"
     primer_bind     complement(162..178)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     terminator      391..477
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     terminator      569..596
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     promoter        615..706
                     /gene="bla"
                     /label=AmpR promoter
     rep_origin      924..3989
                     /label=derived from Corynebacterium glutamicum pCG1
                     /note="derived from Corynebacterium glutamicum pCG1"
     CDS             complement(4572..5387)
                     /codon_start=1
                     /gene="neo"
                     /locus_tag="pVWEx1_neo"
                     /product="kanamycin kinase"
                     /label=neo
                     /note="aminoglycoside 3'-phosphotransferase"
                     /protein_id="ARU80374.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            complement(4572..5387)
                     /gene="neo"
                     /locus_tag="pVWEx1_neo"
                     /label=neo
     rep_origin      complement(5715..6544)
                     /direction=LEFT
                     /label=derived from Escherichia coli p15A
                     /note="derived from Escherichia coli p15A"
     rep_origin      complement(5982..6527)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(7232..8323)
                     /codon_start=1
                     /gene="lacI"
                     /locus_tag="pVWEx1_lacI"
                     /product="lactose operon repressor"
                     /label=lacI
                     /note="LacI"
                     /protein_id="ARU80375.1"
                     /translation="MVNVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM
                     AELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVER
                     SGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
                     FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
                     WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTED
                     SSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTA
                     SPRALADSLMQLARQVSRLESGQ"
     gene            complement(7232..8323)
                     /gene="lacI"
                     /locus_tag="pVWEx1_lacI"
                     /label=lacI
     CDS             complement(7232..8314)
                     /codon_start=1
                     /gene="lacI"
                     /product="lac repressor"
                     /label=lacI
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
                     ALADSLMQLARQVSRLESGQ"
     promoter        complement(8315..8392)
                     /gene="lacI (mutant)"
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the 
                     promoter boosts expression of the lacI gene about 10-fold."

This page is informational only.