Basic Vector Information
pVWEx1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVWEx1 vector Sequence
LOCUS 40924_46138 8619 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVWEx1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8619) AUTHORS Bekel T, Stadermann KB, Voss M. TITLE Nucleotide sequence analysis of the plasmid pVWEx1 by Illumina sequencing technology JOURNAL Unpublished REFERENCE 2 (bases 1 to 8619) AUTHORS Bekel T, Stadermann KB, Voss M. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 8619) TITLE Direct Submission REFERENCE 4 (bases 1 to 8619) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-APR-2017) Evonik Nutrition " COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 9 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8619 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 7..35 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 43..59 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature complement(105..161) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(162..178) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 391..477 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 569..596 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 615..706 /label=AmpR promoter rep_origin 924..3989 /label=derived from Corynebacterium glutamicum pCG1 /note="derived from Corynebacterium glutamicum pCG1" CDS complement(4575..5387) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin complement(5982..6527) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(7235..8314) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(8315..8392) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold."
This page is informational only.