Basic Vector Information
- Vector Name:
- pVTLU260
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7357 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Mok CSL., Melcher K.
- Promoter:
- ADH1
pVTLU260 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVTLU260 vector Sequence
LOCUS 40924_46128 7357 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pVTLU260, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7357) AUTHORS Mok CSL., Melcher K. TITLE Direct Submission JOURNAL Submitted (25-MAR-2005) School of Biomedical Sciences, University of Ulster, Cromore Road, Coleraine BT52 1SA, UK REFERENCE 2 (bases 1 to 7357) TITLE Direct Submission REFERENCE 3 (bases 1 to 7357) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (25-MAR-2005) School of Biomedical Sciences, University of Ulster, Cromore Road, Coleraine BT52 1SA, UK" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..7357 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 24..244 /label=URA3 promoter CDS 245..1045 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" promoter 1246..1350 /label=AmpR promoter CDS 1351..2208 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDVGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2382..2970 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2999..3400 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1" CDS 3412..3429 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 3436..3456 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" terminator 3639..3826 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" rep_origin 3837..5183 /label=2u ori /note="yeast 2u plasmid origin of replication" CDS 5557..6648 /codon_start=1 /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" /translation="MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHL IGGAAIDATGVPLPDEALEASKKVDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA NLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYT VPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQ LIDSAAMILVKNPTHLNGIIITSNMFGDIISDEALRYPGSLGLLPSASLASLPDKNTAF GLYEPCHGSAPGFAKNKVDPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG DLGGSNSTTEVGDAVAEEVKKILA" primer_bind 7319..7335 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.