Basic Vector Information
pVLG6 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVLG6 vector Sequence
LOCUS 40924_46023 6607 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVLG6, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6607) AUTHORS Zeigler DR. TITLE Sequence of pVLG6, a shuttle vector for constructing GFP fusions in Bacillus megaterium and other Gram-positive bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 6607) AUTHORS Zeigler DR. TITLE Direct Submission JOURNAL Submitted (18-APR-2011) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA REFERENCE 3 (bases 1 to 6607) TITLE Direct Submission REFERENCE 4 (bases 1 to 6607) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-APR-2011) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6607 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 18..34 /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS 61..774 /label=GFP /note="green fluorescent protein" primer_bind complement(792..808) /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS 1202..1387 /codon_start=1 /gene="cop" /product="Cop" /label=cop /note="copy control regulatory protein for Gram-positive replication" /protein_id="AEP13839.1" /translation="MLGGTVMVVDRKEEKKVAVTLRLTTEENEILNRIKEKYNISKSDA TGILIKKYAKEEYGAF" gene 1202..1387 /gene="cop" /label=cop CDS 1468..2067 /codon_start=1 /gene="repF" /product="RepF" /label=repF /note="initiation protein for Gram-positive replication" /protein_id="AEP13838.1" /translation="MSENVIKETENKKNSRGRNWTFVLYPESAKAEWLEYLKELHIQFV VSPLHDRDTDTEGRMKKEHYHILVMYEGNKSYEQIKIITEELNATIPQIAGSVKGLVRY MLHMDDPNKFKYQKEDMIVYGGVDVDELLKKTTTDRYKLIKEMIEFIDEQGIVEFKSLM DYAMKFKFDDWFPLLCDNSAYVIQEYIKSNRYKSDR" gene 1468..2067 /gene="repF" /label=repF promoter complement(2703..2721) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2728..2744) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(2885..3340) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3367..3471 /label=AmpR promoter CDS 3472..4329 /label=AmpR /note="beta-lactamase" rep_origin 4503..5091 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5458..6105) /gene="cat" /label=cat /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" protein_bind 6443..6464 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6479..6509 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6517..6533 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6541..6557 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 6578..6596 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.