pVLG6 vector (V002235)

Basic Vector Information

      • Vector Name:
      • pVLG6
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 6607 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Zeigler DR.

pVLG6 vector Vector Map

pVLG66607 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600KS primerGFPSK primerCopRepFT7 promoterM13 fwdf1 oriAmpR promoterAmpRoricatCAP binding sitelac promoterlac operatorM13 revT3 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pVLG6 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_46023        6607 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVLG6, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6607)
  AUTHORS   Zeigler DR.
  TITLE     Sequence of pVLG6, a shuttle vector for constructing GFP fusions in 
            Bacillus megaterium and other Gram-positive bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6607)
  AUTHORS   Zeigler DR.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-2011) Bacillus Genetic Stock Center, The Ohio 
            State University, 484 W 12th Ave, Columbus, OH 43210, USA
REFERENCE   3  (bases 1 to 6607)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6607)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-APR-2011) Bacillus Genetic Stock Center, The Ohio State 
            University, 484 W 12th Ave, Columbus, OH 43210, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6607
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     18..34
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             61..774
                     /label=GFP
                     /note="green fluorescent protein"
     primer_bind     complement(792..808)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1202..1387
                     /codon_start=1
                     /gene="cop"
                     /product="Cop"
                     /label=cop
                     /note="copy control regulatory protein for Gram-positive 
                     replication"
                     /protein_id="AEP13839.1"
                     /translation="MLGGTVMVVDRKEEKKVAVTLRLTTEENEILNRIKEKYNISKSDA
                     TGILIKKYAKEEYGAF"
     gene            1202..1387
                     /gene="cop"
                     /label=cop
     CDS             1468..2067
                     /codon_start=1
                     /gene="repF"
                     /product="RepF"
                     /label=repF
                     /note="initiation protein for Gram-positive replication"
                     /protein_id="AEP13838.1"
                     /translation="MSENVIKETENKKNSRGRNWTFVLYPESAKAEWLEYLKELHIQFV
                     VSPLHDRDTDTEGRMKKEHYHILVMYEGNKSYEQIKIITEELNATIPQIAGSVKGLVRY
                     MLHMDDPNKFKYQKEDMIVYGGVDVDELLKKTTTDRYKLIKEMIEFIDEQGIVEFKSLM
                     DYAMKFKFDDWFPLLCDNSAYVIQEYIKSNRYKSDR"
     gene            1468..2067
                     /gene="repF"
                     /label=repF
     promoter        complement(2703..2721)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2728..2744)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      complement(2885..3340)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        3367..3471
                     /label=AmpR promoter
     CDS             3472..4329
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4503..5091
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5458..6105)
                     /gene="cat"
                     /label=cat
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     protein_bind    6443..6464
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        6479..6509
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6517..6533
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     6541..6557
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6578..6596
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"

This page is informational only.