Basic Vector Information
pVK9PtacMuAB vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVK9PtacMuAB vector Sequence
LOCUS 40924_46003 10172 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVK9PtacMuAB, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10172) AUTHORS Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV. TITLE Genetic tools C. glutamicum JOURNAL Unpublished REFERENCE 2 (bases 1 to 10172) AUTHORS Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV. TITLE Direct Submission JOURNAL Submitted (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow 117545, Russia REFERENCE 3 (bases 1 to 10172) TITLE Direct Submission REFERENCE 4 (bases 1 to 10172) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow 117545, Russia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10172 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(463..1857) /codon_start=1 /gene="rep" /product="Rep" /label=rep /note="replication protein of pCG1 plasmid from C. glutamicum" /protein_id="AKN19584.1" /translation="MTLADSRDIDTPAWKFSADLFDTHPELALRSRGWTSEDRREFLAH LGRENFQGSKTRDFASAWIKDPDTGETQPKLYRVGSKSLARCQYVALTHAQHAAVLVLD IDVPSHQAGGKIEHVNPEVYAILERWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAAAG MSSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYRWHAQHNRVDRLADL MEVARMISGTEKPKKRYEQEFSSGRARIEAARKATAEAKALATLEASLPSAAEASGELI DGVRVLWTAPGRAARDETAFRHALTVGYQLKAAGERLKDTKIIDAYERAYTVAQAVGAD GREPDLPPMRDRQTMARRVRGYVAKGQPVVPARQTETQSSRGRKALATMGRRGGKKAAE RWKDPNSEYARAQREKLAKSSQRQARKAKGNRLTIAGWFMTVEGETGSWRQSMKLCLNL ACHVRP" gene complement(463..1857) /gene="rep" /label=rep CDS complement(2999..3529) /label=GmR /note="gentamycin acetyltransferase" promoter complement(3718..3746) /label=Pc promoter /note="class 1 integron promoter" primer_bind 4150..4166 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(4215..5294) /label=lacI /note="lac repressor" promoter complement(5295..5372) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 5390..5418 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 5426..5442 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 5480..7468 /gene="A" /label=A /note="DDE-recombinase A from Escherichia phage Mu. Accession#: P07636" CDS 7510..8445 /gene="B" /label=B /note="ATP-dependent target DNA activator B from Escherichia phage Mu. Accession#: P03763" primer_bind complement(8943..8959) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 8967..8983 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(8991..9021) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(9036..9057) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(9529..10117) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.