pVK9PtacMuAB vector (V002236)

Basic Vector Information

      • Vector Name:
      • pVK9PtacMuAB
      • Antibiotic Resistance:
      • Gentamicin
      • Length:
      • 10172 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV.

pVK9PtacMuAB vector Vector Map

pVK9PtacMuAB10172 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000RepGmRPc promoterM13 fwdlacIlacIq promotertac promoterlac operatorABM13 revlac operatorlac promoterCAP binding siteori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pVK9PtacMuAB vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_46003       10172 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVK9PtacMuAB, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10172)
  AUTHORS   Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV.
  TITLE     Genetic tools C. glutamicum
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10172)
  AUTHORS   Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow
            117545, Russia
REFERENCE   3  (bases 1 to 10172)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10172)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow 117545, 
            Russia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10172
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(463..1857)
                     /codon_start=1
                     /gene="rep"
                     /product="Rep"
                     /label=rep
                     /note="replication protein of pCG1 plasmid from C.
                     glutamicum"
                     /protein_id="AKN19584.1"
                     /translation="MTLADSRDIDTPAWKFSADLFDTHPELALRSRGWTSEDRREFLAH
                     LGRENFQGSKTRDFASAWIKDPDTGETQPKLYRVGSKSLARCQYVALTHAQHAAVLVLD
                     IDVPSHQAGGKIEHVNPEVYAILERWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAAAG
                     MSSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYRWHAQHNRVDRLADL
                     MEVARMISGTEKPKKRYEQEFSSGRARIEAARKATAEAKALATLEASLPSAAEASGELI
                     DGVRVLWTAPGRAARDETAFRHALTVGYQLKAAGERLKDTKIIDAYERAYTVAQAVGAD
                     GREPDLPPMRDRQTMARRVRGYVAKGQPVVPARQTETQSSRGRKALATMGRRGGKKAAE
                     RWKDPNSEYARAQREKLAKSSQRQARKAKGNRLTIAGWFMTVEGETGSWRQSMKLCLNL
                     ACHVRP"
     gene            complement(463..1857)
                     /gene="rep"
                     /label=rep
     CDS             complement(2999..3529)
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     promoter        complement(3718..3746)
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     primer_bind     4150..4166
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(4215..5294)
                     /label=lacI
                     /note="lac repressor"
     promoter        complement(5295..5372)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     promoter        5390..5418
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    5426..5442
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             5480..7468
                     /gene="A"
                     /label=A
                     /note="DDE-recombinase A from Escherichia phage Mu.
                     Accession#: P07636"
     CDS             7510..8445
                     /gene="B"
                     /label=B
                     /note="ATP-dependent target DNA activator B from
                     Escherichia phage Mu. Accession#: P03763"
     primer_bind     complement(8943..8959)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8967..8983
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8991..9021)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(9036..9057)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(9529..10117)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.