Basic Vector Information
- Vector Name:
- pVIK111
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9336 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pVIK111 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVIK111 vector Sequence
LOCUS 40924_45963 9336 bp DNA circular SYN 18-DEC-2018 DEFINITION Suicide vector pVIK111, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9336) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 9336) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 9336) TITLE Direct Submission REFERENCE 4 (bases 1 to 9336) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9336 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 98..3142 /label=lacZ /note="beta-galactosidase" CDS 3197..4447 /gene="lacY" /label=lacY /note="Lactose permease from Escherichia coli (strain K12). Accession#: P02920" CDS 4514..5061 /codon_start=1 /note="unnamed protein product; lacA fragment" /protein_id="SJL88070.1" /translation="LNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI VTKDIPPNVVAAGVPCRVI" CDS 5417..6208 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS complement(7768..8136) /label=traJ /note="oriT-recognizing protein" oriT complement(8169..8278) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 8922..9278 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.