pVIK107 vector (V002243)

MSDS

Basic Vector Information

Vector Name:: pVIK107

Antibiotic Resistance:: Kanamycin

Length:: 9335 bp

Type:: Suicide vector

Replication origin:: R6K γ ori

Source/Author:: De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.

pVIK107 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pVIK107 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_45953        9335 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Suicide vector pVIK107, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9335)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9335)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 9335)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9335)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9335
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             88..3141
                     /label=lacZ
                     /note="beta-galactosidase"
     CDS             3196..4446
                     /gene="lacY"
                     /label=lacY
                     /note="Lactose permease from Escherichia coli (strain K12).
                     Accession#: P02920"
     CDS             4513..5060
                     /codon_start=1
                     /note="unnamed protein product; lacA fragment"
                     /protein_id="SJL88062.1"
                     /translation="LNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE
                     KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
                     APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
                     VTKDIPPNVVAAGVPCRVI"
     CDS             5416..6207
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             complement(7767..8135)
                     /label=traJ
                     /note="oriT-recognizing protein"
     oriT            complement(8168..8277)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     rep_origin      8921..9277
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"

This page is informational only.