Basic Vector Information
- Vector Name:
- pVC4-bar
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11224 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Conn SJ, Conn V, Tyerman SD, Kaiser BN, Leigh RA, Gilliham M.
- Promoter:
- CaMV 35S (enhanced)
pVC4-bar vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pVC4-bar vector Sequence
LOCUS 40924_45898 11224 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pVC4-bar, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11224) AUTHORS Conn SJ, Conn V, Tyerman SD, Kaiser BN, Leigh RA, Gilliham M. TITLE Magnesium transporters, MGT2/MRS2-1 and MGT3/MRS2-5, are important for magnesium partitioning within Arabidopsis thaliana mesophyll vacuoles JOURNAL New Phytol. 190 (3), 583-594 (2011) PUBMED 21261624 REFERENCE 2 (bases 1 to 11224) AUTHORS Conn V. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 11224) TITLE Direct Submission REFERENCE 4 (bases 1 to 11224) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "New Phytol."; date: "2011"; volume: "190"; issue: "3"; pages: "583-594" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-AUG-2010) Agriculture, Food " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11224 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(82..106) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" promoter 526..870 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" primer_bind 1078..1094 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 1175..1299 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1324..1354 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1408..2064 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" CDS 2409..2711 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2755..2879) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" terminator 2912..3159 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(3191..3207) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 3215..3231 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3239..3269) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3284..3305) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3496..4173 /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" CDS 4218..4766 /codon_start=1 /label=BlpR /note="phosphinothricin acetyltransferase" /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF WQLDFSLPVPPRPVLPVTEI" polyA_signal 4776..4950 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" misc_feature complement(5028..5052) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5477..6268 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" rep_origin 6358..6946 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(7132..7272) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7616..7810) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7879..8943) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" CDS complement(9380..10006) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.