pVA838 vector (V002258)

MSDS

Basic Vector Information

- - Vector Name:
  - pVA838
- - Antibiotic Resistance:
  - Tetracycline
- - Length:
  - 9065 bp
- - Type:
  - Reporter vector
- - Replication origin:
  - p15A ori
- - Source/Author:
  - Honeyman AL, Cote CK, Curtiss R III.

pVA838 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pVA838 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_45863        9065 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Reporter vector pVA838, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9065)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Construction of transcriptional and translational lacZ gene reporter
            plasmids for use in Streptococcus mutans
  JOURNAL   J. Microbiol. Methods 49 (2), 163-171 (2002)
  PUBMED    11830302
REFERENCE   2  (bases 1 to 9065)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2001) Department of Medical Microbiology and 
            Immunology, University of South Florida, 12901 Bruce B. Downs Blvd.,
            Tampa, FL 33612, USA
REFERENCE   3  (bases 1 to 9065)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9065)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. 
            Microbiol. Methods"; date: "2002"; volume: "49"; issue: "2"; pages: 
            "163-171"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-AUG-2001) Department of Medical Microbiology and Immunology, 
            University of South Florida, 12901 Bruce B. Downs Blvd., Tampa, FL 
            33612, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9065
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             58..1245
                     /label=TcR
                     /note="tetracycline efflux protein"
     CDS             complement(2285..2941)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(2942..3044)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(3570..4115)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             6077..6790
                     /codon_start=1
                     /gene="rep"
                     /product="replication protein"
                     /label=rep
                     /note="required for replication in Gram positive hosts"
                     /protein_id="AAN02503.1"
                     /translation="MKYAYQAELVVNEAMKRYPKGRFLFLTLTIKNISGEKLNKSISEI
                     GRAFNRLMKYKKVDKNVIGYLRATEVTYSTEHENYHPHLHVLLFVKSSYFTGNNTNYIS
                     QEEWTKLWAKAMKLDYTPVVDIRTVKAHKRKNLKSAIIETAKYPVKPFDVDTEDVTLFS
                     EMVKERITEDLTNGLHRKRQIGFGKLFKKIKAELALDDVEEGNLVQTGAEESAESTGRE
                     IVAFWNWDRKNYFVR"
     gene            6077..6790
                     /gene="rep"
                     /label=rep
     CDS             complement(7418..8152)
                     /gene="ermBP"
                     /label=ermBP
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"

This page is informational only.