Basic Vector Information
pUTkm1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUTkm1 vector Sequence
LOCUS 40924_45828 7055 bp DNA circular SYN 18-DEC-2018 DEFINITION Transposon delivery vector pUTkm1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7055) AUTHORS de Lorenzo V, Herrero M, Jakubzik U, Timmis KN. TITLE Mini-Tn5 transposon derivatives for insertion mutagenesis, promoter probing, and chromosomal insertion of cloned DNA in gram-negative eubacteria JOURNAL J. Bacteriol. 172 (11), 6568-6572 (1990) PUBMED 2172217 REFERENCE 2 (bases 1 to 7055) AUTHORS Tombolini R, Jansson J. TITLE Direct Submission JOURNAL Submitted (27-OCT-1998) Department of Biochemistry, Stockholm University, Svante Arrhenius vag. 10-12, Stockholm SE-10691, Sweden REFERENCE 3 (bases 1 to 7055) TITLE Direct Submission REFERENCE 4 (bases 1 to 7055) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Bacteriol."; date: "1990"; volume: "172"; issue: "11"; pages: "6568-6572" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-OCT-1998) Department of Biochemistry, Stockholm University, Svante Arrhenius vag. 10-12, Stockholm SE-10691, Sweden" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7055 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(314..1171) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(1172..1276) /label=AmpR promoter CDS complement(1326..2753) /codon_start=1 /label=Tn5 transposase /note="transposase from the bacterial Tn5 transposon (Reznikoff, 1993)" /translation="MITSALHRAADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGKS ITISSEGSEAMQEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPELLAIEDTTSLSYR HQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDDPADADEKESG KWLAAAATSRLRMGSMMSNVIAVCDREADIHAYLQDKLAHNERFVVRSKHPRKDVESGL YLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNA VLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAER QRMEEPDNLERMVSILSFVAVRLLQLRESFTLPQALRAQGLLKEAEHVESQSAETVLTP DECQLLGYLDKGKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQS KLDGFLAAKDLMAQGIKI" CDS 3394..4206 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" protein_bind complement(4718..4734) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." rep_origin complement(4769..5157) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(5778..6146) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(6179..6288) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.