Basic Vector Information
- Vector Name:
- pUT-dfrA17
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5935 bp
- Type:
- Mini Tn5 transposon vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Tsai Y, Chu C, Lee C-H., Liaw S-J.
pUT-dfrA17 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUT-dfrA17 vector Sequence
LOCUS 40924_45798 5935 bp DNA circular SYN 18-DEC-2018
DEFINITION Mini Tn5 transposon vector pUT-dfrA17, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5935)
AUTHORS Tsai Y, Chu C, Lee C-H., Liaw S-J.
TITLE Direct Submission
JOURNAL Submitted (24-OCT-2013) Department of Clinical Laboratory Sciences
and Medical Biotechnology, College of Medicine, National Taiwan
University, No. 1, Chang-Te St., Taipei 100, Taiwan
REFERENCE 2 (bases 1 to 5935)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 5935)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(24-OCT-2013) Department of Clinical Laboratory Sciences and Medical
Biotechnology, College of Medicine, National Taiwan University, No.
1, Chang-Te St., Taipei 100, Taiwan"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5935
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(314..1171)
/label=AmpR
/note="beta-lactamase"
promoter complement(1172..1276)
/label=AmpR promoter
CDS complement(1326..2753)
/label=Tn5 transposase
/note="transposase from the bacterial Tn5 transposon
(Reznikoff, 1993)"
misc_feature 2871..2889
/note="Tn5 inside end; IE"
CDS 3007..3555
/codon_start=1
/gene="dfrA17"
/product="dihydrofolate reductase DfrA17"
/label=dfrA17
/protein_id="AHG52772.1"
/translation="MLWSSNDVTQQGSRPKTKLAIKGVKLKISLISAVSENGVIGSGPD
IPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSKNGISSSNENVLVFPS
IENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDIKFPIMPENFNLV
FEQFFMSNINYTYQIWKKG"
gene 3007..3555
/gene="dfrA17"
/label=dfrA17
misc_feature 3568..3586
/note="Tn5 outside end; OE"
protein_bind complement(3598..3614)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
rep_origin complement(3649..4037)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
CDS complement(4658..5026)
/label=traJ
/note="oriT-recognizing protein"
oriT complement(5059..5168)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
This page is informational only.