Basic Vector Information
pUMat-attB-GFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUMat-attB-GFP vector Sequence
LOCUS 40924_45723 10443 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pUMat-attB-GFP, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10443)
AUTHORS Irion U.
TITLE Direct Submission
JOURNAL Submitted (16-MAY-2018) ECNV, Max Planck Institute for Developmental
Biology, Max-Planck-Ring 5, Tuebingen 72076, Germany
REFERENCE 2 (bases 1 to 10443)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 10443)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(16-MAY-2018) ECNV, Max Planck Institute for Developmental Biology,
Max-Planck-Ring 5, Tuebingen 72076, Germany"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..10443
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 4..459
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 623..641
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
gene 666..4802
/label=mini-white
/note="This modified version of the white gene lacks part
of the first intron."
regulatory 4808..6803
/gene="alpha Tub67C"
/label=promoter from Drosophila melanogaster
/note="promoter from Drosophila melanogaster"
/regulatory_class="promoter"
gene 4808..6803
/gene="alpha Tub67C"
/label=alpha Tub67C
CDS 6819..7640
/codon_start=1
/product="mGFP6"
/label=mGFP6
/protein_id="AYK27211.1"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKA
NFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALDPNEKRDHMVLLEFV
TAAGITHGMDELYKLEVDGIDKLDIEFLQPGGSHMRSRPTSSRACSPGDPI"
primer_bind 7529..7545
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
regulatory 7690..7934
/label=alphaTub84B 3'UTR
/note="alphaTub84B 3'UTR"
/regulatory_class="terminator"
protein_bind 7967..8036
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
promoter complement(8255..8273)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(8294..8310)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 8318..8334
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(8342..8372)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(8387..8408)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(8696..9284)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(9458..10315)
/label=AmpR
/note="beta-lactamase"
promoter complement(10316..10420)
/label=AmpR promoter
This page is informational only.