Basic Vector Information
- Vector Name:
- pUDE202
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11861 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kozak BU, van Rossum HM, Benjamin KR, Wu L, Daran JM, Pronk JT, van Maris AJ.
- Promoter:
- TPI1
pUDE202 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUDE202 vector Sequence
LOCUS 40924_45448 11861 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pUDE202, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11861) AUTHORS Kozak BU, van Rossum HM, Benjamin KR, Wu L, Daran JM, Pronk JT, van Maris AJ. TITLE Replacement of the Saccharomyces cerevisiae acetyl-CoA synthetases by alternative pathways for cytosolic acetyl-CoA synthesis JOURNAL Metab. Eng. (2013) In press PUBMED 24269999 REFERENCE 2 (bases 1 to 11861) AUTHORS Kozak BU, van Rossum HM, Benjamin KR, Wu L, Daran J-M.G., Pronk JT, van Maris AJA. TITLE Direct Submission JOURNAL Submitted (31-MAY-2013) Biotechnology, Delft University of Technology, Julianalaan 67, Delft 2628BC, The Netherlands REFERENCE 3 (bases 1 to 11861) TITLE Direct Submission REFERENCE 4 (bases 1 to 11861) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng. (2013) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAY-2013) Biotechnology, Delft University of Technology, Julianalaan 67, Delft 2628BC, The Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: IDBA v. 0.20 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..11861 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(233..821) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(995..1852) /label=AmpR /note="beta-lactamase" promoter complement(1853..1957) /gene="bla" /label=AmpR promoter rep_origin complement(1984..3326) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 3588..3803 /label=URA3 promoter CDS 3804..4604 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" rep_origin complement(4738..5193) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 5334..5350 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 5360..5378 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 5888..6407 /label=TPI1 promoter /note="strong constitutive promoter for yeast triose phosphate isomerase" CDS 6408..8720 /codon_start=1 /gene="pfl" /product="pyruvate formate lyase" /label=pfl /protein_id="AHB33308.1" /translation="MAAASAAAEALPVAPSHSCAADPDKHPHLPDPRPKPAVDAGINVQ KYVQDNYTAYAGNSSFLAGPTDNTKKLWSELEKMIATEIEKGVMDVDPSKPSTITAFPP GYIDKDLETVVGLQTDAPLKRAIKPLGGVNMVKAALESYGYTPDPEVARLYSTVRKTHN SGVFDAYTDEMRAARKSGILSGLPDGYGRGRIIGDYRRVALYGVDALIKAKKTDLKHNL LGVMDEEKIRLREEVNEQIRALSELKEMGAAYGFDLSRPAANSREAVQWLYFGYLGAVK EQDGAAMSLGRIDAFLDTYFERDLKAGTITEAEVQELIDHFVMKLRIVRQLRTPEYNAL FAGDPTWVTCVLGGTDASGKAMVTKTSFRLLNTLYNLGPAPEPNLTVLWNDNLPAPFKE FCAKVSLDTSSIQYESDNLMSKLFGSDYSIACCVSAMRVGKDMQYFGARANLPKLLLYT LNGGRDEVSGDQVGPKFAPVRSPTAPLDYEEVKAKIEDGMEWLASMYANTMNIIHYMHD KYDYERLQMALHDTHVRRLLAFGISGLSVVTDSLSAIEYAQVTPVIDERGLMTDFKVEG SFPKYGNDDDRVDEIAEWVVSTFSSKLAKQHTYRNSVPTLSVLTITSNVVYGKKTGSTP DGRKKGEPIAPGDNPLHGRDAHGALASLNSVAKLPYTMCLDGISNTFSLIPQVLGRGGE HERATNLASILDGYFANGGHHINVNVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARL TREQQLEVIARTFHDTM" gene 6408..8720 /gene="pfl" /label=pfl regulatory 8671..9171 /label=GND2 terminator /note="GND2 terminator" /regulatory_class="terminator" regulatory 9176..10176 /label=FBA1 promoter /note="FBA1 promoter" /regulatory_class="promoter" CDS 10227..11048 /codon_start=1 /gene="pflA" /product="PFL activating enzyme" /label=pflA /protein_id="AHB33309.1" /translation="MERLQPKLSTNYSVVLPQYEPTDPSGIPEVFGNVHSTESMSAVDG PGVRFLVFVQGCAMRCLFCSNPDTWTLKGGNKTSSKEIAADIKRVRNYLKPRGGITISG GEAMLQPHFVSTVFQEVHALGLNTTVDTTGQGTKAGNWDVVLPHTDLVLFCIKHIDPIK YEALTGMKQRGALRFADQLAERKIPFYLRYVYIPGYTDGVKDIDKLIEWCKQQPTFQGI ELLPYHVLGRNKWEVMGLPYPLDGTNTPPHEQVRAVIKVFNDNDVPVICAE" gene 10227..11048 /gene="pflA" /label=pflA regulatory 10999..11499 /label=PMA1 terminator /note="PMA1 terminator" /regulatory_class="terminator" primer_bind complement(11550..11566) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(11603..11621) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(11642..11658) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 11666..11682 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(11690..11720) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(11735..11756) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP."
This page is informational only.