Basic Vector Information
- Vector Name:
- pUDC082
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10005 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Beekwilder J, van Rossum H.
- Promoter:
- GPD
pUDC082 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUDC082 vector Sequence
LOCUS 40924_45413 10005 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pUDC082, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10005)
AUTHORS Beekwilder J, van Rossum H.
TITLE Production of carotenoids in Saccharomyces cerevisiae by a
self-processing polyprotein and conversion to beta-ionone
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 10005)
AUTHORS Beekwilder J, van Rossum H.
TITLE Direct Submission
JOURNAL Submitted (13-SEP-2013) BU Bioscience, Plant Research International,
P.O.Box 619, Wageningen, Gelderland 6700AP, Netherlands
REFERENCE 3 (bases 1 to 10005)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10005)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-SEP-2013) BU Bioscience, Plant Research International, P.O.Box
619, Wageningen, Gelderland 6700AP, Netherlands"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: IDBA v. 1
Coverage :: 160
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..10005
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 7..650
/label=GAP promoter
/note="promoter for glyceraldehyde-3-phosphate
dehydrogenase; also known as the TDH3 promoter"
primer_bind 656..672
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
CDS 674..2692
/gene="crtYB"
/label=crtYB
/note="Bifunctional lycopene cyclase/phytoene synthase from
Phaffia rhodozyma. Accession#: Q7Z859"
CDS 2699..2752
/label=T2A
/note="2A peptide from Thosea asigna virus capsid protein"
misc_feature 2753..4495
/note="phytoene desaturase from Xanthophyllomyces
dendrorhous; Region: CrtI"
misc_feature 4496..4555
/label=Region: T2A ribosomal skipping sequence
/note="Region: T2A ribosomal skipping sequence"
CDS 4502..4555
/codon_start=1
/product="2A peptide from Thosea asigna virus capsid
protein"
/label=T2A
/note="Eukaryotic ribosomes fail to insert a peptide bond
between the Gly and Pro residues, yielding separate
polypeptides."
/translation="EGRGSLLTCGDVEENPGP"
CDS 5091..5102
/label=Factor Xa site
/note="Factor Xa recognition and cleavage site"
terminator 5748..5945
/label=TEF terminator
/note="Ashbya gossypii TEF terminator"
CDS 6439..7242
/codon_start=1
/product="orotidine-5'-phosphate decarboxylase"
/label=orotidine-5'-phosphate decarboxylase
/note="URA3; derived from Kluyveromyces lactis"
/protein_id="AHZ97959.1"
/translation="MSTKSYTSRAETHASPVASKLLRLMDEKKTNLCASLDVRSTDELL
KLVETLGPYICLLKTHVDILDDFSYEGTVVPLKALAEKYKFLIFEDRKFADIGNTVKLQ
YTSGVYRIAEWSDITNAHGVTGAGIVAGLKQGAQEVTKEPRGLLMLAELSSKGSLAHGE
YTKGTVDIAKSDKDFVIGFIAQNDMGGREEGFDWLIMTPGVGLDDKGDALGQQYRTVDE
VVSGGSDIIIVGRGLFAKGRDPKVEGERYRNAGWEAYQKRISAPH"
promoter 7426..7530
/label=AmpR promoter
CDS 7531..8388
/label=AmpR
/note="beta-lactamase"
rep_origin 8562..9150
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(9422..9925)
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
This page is informational only.