pUCPRV_BSD2 vector (V002353)

LOCUS       40924_45393        6384 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pUCPRV_BSD2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6384)
  AUTHORS   Conlan B, Birch R, Kelso C, Holland S, De Souza AP, Long SP, Beck 
            JL, Whitney SM.
  TITLE     BSD2 is a Rubisco specific assembly chaperone, forms intermediary 
            hetero-oligomeric complexes and is non-limiting to growth in tobacco
  JOURNAL   Plant Cell Environ. (2018) In press
  PUBMED    30375663
REFERENCE   2  (bases 1 to 6384)
  AUTHORS   Conlan B, Birch R, Holland S, Kelso C, De Souza A, Long S, Beck J, 
            Whitney S.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2018) Research School of Biology, Australian 
            National University, 134 Linnaeus Way, Acton, ACT 2601, Australia
REFERENCE   3  (bases 1 to 6384)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6384)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant Cell 
            Environ. (2018) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-OCT-2018) Research School of Biology, Australian National 
            University, 134 Linnaeus Way, Acton, ACT 2601, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
            Nicotiana tabacum chloroplast transformation vector.
FEATURES             Location/Qualifiers
     source          1..6384
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    7..1165
                     /label=Nicotiana tabacum chloroplast flanking sequence
                     /note="Nicotiana tabacum chloroplast flanking sequence"
     regulatory      1181..1396
                     /regulatory_class="promoter"
     CDS             1399..1809
                     /codon_start=1
                     /product="BSD2"
                     /label=BSD2
                     /protein_id="AYR18863.1"
                     /translation="MANSLCFTPLASFNSVNKPGLNLINRNCTGGKIQWIKDATYSSKT
                     NLRVVEVKATDSDKDTKVRSIVCQNCDGNGAVSCSQCKGTGVNSVDHFNGRFKAGGLCW
                     LCRGKKDMLCGDCNGAGFLGGFMSTFDEHHHH"
     CDS             1859..2647
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     misc_feature    2810..3725
                     /label=Nicotiana tabacum chloroplast flanking sequence
                     /note="Nicotiana tabacum chloroplast flanking sequence"
     primer_bind     complement(3768..3784)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3792..3808)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3816..3846)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3861..3882)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4170..4758)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4932..5789)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(5790..5894)
                     /label=AmpR promoter
     primer_bind     6368..6384
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"