Basic Vector Information
- Vector Name:
- pUCPRV_BSD2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6384 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Conlan B, Birch R, Kelso C, Holland S, De Souza AP, Long SP, Beck JL, Whitney SM.
pUCPRV_BSD2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUCPRV_BSD2 vector Sequence
LOCUS 40924_45393 6384 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pUCPRV_BSD2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6384)
AUTHORS Conlan B, Birch R, Kelso C, Holland S, De Souza AP, Long SP, Beck
JL, Whitney SM.
TITLE BSD2 is a Rubisco specific assembly chaperone, forms intermediary
hetero-oligomeric complexes and is non-limiting to growth in tobacco
JOURNAL Plant Cell Environ. (2018) In press
PUBMED 30375663
REFERENCE 2 (bases 1 to 6384)
AUTHORS Conlan B, Birch R, Holland S, Kelso C, De Souza A, Long S, Beck J,
Whitney S.
TITLE Direct Submission
JOURNAL Submitted (28-OCT-2018) Research School of Biology, Australian
National University, 134 Linnaeus Way, Acton, ACT 2601, Australia
REFERENCE 3 (bases 1 to 6384)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6384)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Cell
Environ. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(28-OCT-2018) Research School of Biology, Australian National
University, 134 Linnaeus Way, Acton, ACT 2601, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
Nicotiana tabacum chloroplast transformation vector.
FEATURES Location/Qualifiers
source 1..6384
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 7..1165
/label=Nicotiana tabacum chloroplast flanking sequence
/note="Nicotiana tabacum chloroplast flanking sequence"
regulatory 1181..1396
/regulatory_class="promoter"
CDS 1399..1809
/codon_start=1
/product="BSD2"
/label=BSD2
/protein_id="AYR18863.1"
/translation="MANSLCFTPLASFNSVNKPGLNLINRNCTGGKIQWIKDATYSSKT
NLRVVEVKATDSDKDTKVRSIVCQNCDGNGAVSCSQCKGTGVNSVDHFNGRFKAGGLCW
LCRGKKDMLCGDCNGAGFLGGFMSTFDEHHHH"
CDS 1859..2647
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
misc_feature 2810..3725
/label=Nicotiana tabacum chloroplast flanking sequence
/note="Nicotiana tabacum chloroplast flanking sequence"
primer_bind complement(3768..3784)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3792..3808)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3816..3846)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3861..3882)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4170..4758)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4932..5789)
/label=AmpR
/note="beta-lactamase"
promoter complement(5790..5894)
/label=AmpR promoter
primer_bind 6368..6384
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.