Basic Vector Information
pUChTNFR75f vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUChTNFR75f vector Sequence
LOCUS 40924_45273 5095 bp DNA circular SYN 18-DEC-2018
DEFINITION Bacterial expression vector pUChTNFR75f, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5095)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5095)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 5095)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5095)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5095
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(403..1512)
/label=3UTR
/note="3UTR"
CDS complement(1513..2803)
/codon_start=1
/note="unnamed protein product; TNFRf"
/protein_id="SJL88754.1"
/translation="RPGAREHMPAQRIL*PDSSDVLQQMLAGPTCKSLLYQDLGHRV*L
L*GQHIHPALELGSRVLELWLPL*L*PGGNSSLHSGTEPHLHLQARLVLRAEQAGGVPA
VRAAAQVPPGLRRGQTRN*NIRRGVQALCPGDVLQHDFIHGYLQAPPDL*RGGHPWECK
HGCSLHVHVPHPEYGPRGSTLTPASVHTIPTHAANSRTQHCSKHLLPAPNGPQPPS*RE
HWRLRSSSWTDCGCDSLGSTNNRSGELCHHDPGEKEALVPAERSQGASLACR*GPGYTG
PRAAAPADHSAELQQQLPGELGQCVGQKGAHSEPATGTRRGGQWGRGGPGQHRELRFFP
WWPWDPGQCHLHRERL*QL*PQLTVLLPSQLHNGRHRFQPLGVPEGRAGPLLQGGMCLS
VTAGDARDPAGEHRREAPAPWSA*CWDEAQL"
misc_feature 2805..2861
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(2874..2890)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2898..2914)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2922..2952)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2967..2988)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(3276..3864)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4038..4895)
/label=AmpR
/note="beta-lactamase"
promoter complement(4896..5000)
/label=AmpR promoter
This page is informational only.