Basic Vector Information
pUChTNFR75f vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUChTNFR75f vector Sequence
LOCUS 40924_45273 5095 bp DNA circular SYN 18-DEC-2018 DEFINITION Bacterial expression vector pUChTNFR75f, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5095) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5095) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5095) TITLE Direct Submission REFERENCE 4 (bases 1 to 5095) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5095 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(403..1512) /label=3UTR /note="3UTR" CDS complement(1513..2803) /codon_start=1 /note="unnamed protein product; TNFRf" /protein_id="SJL88754.1" /translation="RPGAREHMPAQRIL*PDSSDVLQQMLAGPTCKSLLYQDLGHRV*L L*GQHIHPALELGSRVLELWLPL*L*PGGNSSLHSGTEPHLHLQARLVLRAEQAGGVPA VRAAAQVPPGLRRGQTRN*NIRRGVQALCPGDVLQHDFIHGYLQAPPDL*RGGHPWECK HGCSLHVHVPHPEYGPRGSTLTPASVHTIPTHAANSRTQHCSKHLLPAPNGPQPPS*RE HWRLRSSSWTDCGCDSLGSTNNRSGELCHHDPGEKEALVPAERSQGASLACR*GPGYTG PRAAAPADHSAELQQQLPGELGQCVGQKGAHSEPATGTRRGGQWGRGGPGQHRELRFFP WWPWDPGQCHLHRERL*QL*PQLTVLLPSQLHNGRHRFQPLGVPEGRAGPLLQGGMCLS VTAGDARDPAGEHRREAPAPWSA*CWDEAQL" misc_feature 2805..2861 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(2874..2890) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2898..2914) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2922..2952) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2967..2988) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3276..3864) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4038..4895) /label=AmpR /note="beta-lactamase" promoter complement(4896..5000) /label=AmpR promoter
This page is informational only.