Basic Vector Information
- Vector Name:
- pUAST-CTAP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9627 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Veraksa A, Bauer A, Artavanis-Tsakonas S.
- Promoter:
- hsp70
pUAST-CTAP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pUAST-CTAP vector Sequence
LOCUS 40924_44744 9627 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUAST-CTAP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9627) AUTHORS Veraksa A, Bauer A, Artavanis-Tsakonas S. TITLE Analyzing protein complexes in Drosophila with tandem affinity purification-mass spectrometry JOURNAL Dev. Dyn. 232 (3), 827-834 (2005) PUBMED 15704125 REFERENCE 2 (bases 1 to 9627) AUTHORS Veraksa A, Bauer A, Artavanis-Tsakonas S. TITLE Direct Submission JOURNAL Submitted (17-AUG-2004) MGH Cancer Center, Harvard Medical School, Bldg 149, 13th Street, Charlestown, MA 02129, USA REFERENCE 3 (bases 1 to 9627) TITLE Direct Submission REFERENCE 4 (bases 1 to 9627) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Dev. Dyn."; date: "2005"; volume: "232"; issue: "3"; pages: "827-834" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-AUG-2004) MGH Cancer Center, Harvard Medical School, Bldg 149, 13th Street, Charlestown, MA 02129, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9627 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(235..823) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(997..1854) /label=AmpR /note="beta-lactamase" promoter complement(1855..1959) /label=AmpR promoter misc_feature complement(2761..2993) /label=P element 3' end /note="P element 3' end" protein_bind 3055..3149 /label=5X UAS /note="five tandem copies of the 'ScaI site' 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" promoter 3168..3406 /label=hsp70 promoter /note="Drosophila melanogaster hsp70Bb promoter" misc_feature 3420..3465 /note="polylinker; unique cloning sites for EcoRI, EagI/NotI, XhoI, KpnI, XbaI; XbaI site is dam methylation sensitive" CDS 3475..3552 /label=CBP /note="calmodulin-binding peptide" CDS 3580..3600 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" CDS 3640..3813 /label=ProtA /note="IgG-binding unit of Staphylococcus aureus protein A" CDS 3817..3987 /codon_start=1 /product="IgG-binding unit of Staphylococcus aureus protein A" /label=ProtA /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA EAKKLNGAQAPK" intron 4103..4168 /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS 4298..4318 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 4743..4877 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" gene 4895..9031 /label=mini-white /note="This modified version of the white gene lacks part of the first intron." misc_feature complement(9042..9627) /label=P element 5' end
This page is informational only.