Basic Vector Information
- Vector Name:
- pTrcmelA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5989 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pTrcmelA vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTrcmelA vector Sequence
LOCUS 40924_43978 5989 bp DNA circular SYN 18-DEC-2018
DEFINITION Bacterial expression vector pTrcmelA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5989)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5989)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 5989)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5989)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5989
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(41..1870)
/codon_start=1
/note="unnamed protein product; melA"
/protein_id="SJL86559.1"
/translation="MAWLVGKPSLERSWNAILSFPESGFQLECRNTIGSSVFSSHFTLH
FRVARRLLHFSCRRFTETQKEPTQALWWCELPTAPAPRRRGTGLKAALILAKDNSNPRE
SKMSITRRHVIVQGGVIAAGLLASGLPGTKAFAQIPSIPWRRSLQGLAWNDPIIETYRD
AVRLLNALPASDKFNWVNLSKIHGSGDVVKYCPHGNWYFLPWHRAYTAMYERIVRHVTK
NNDFAMPFWDWTDNPYLPEVFTMQKTPDGKDNPLYVSSRTWPITQPMPDNIVGPQVLNT
ILTAKPYEVFGTTRPEGQNSLDPSWVTTSSGTQGALEYTPHNQVHNNIGGWMPEMSSPR
DPIFFMHHCNIDRIWATWNLRNANSTDRLWADMPFTDNFYDVDGNFWSPKVSDLYVPEE
LGYNYGFRTYFKVAAASAKTLALNDKLTSVIAATATDAAIAGVTTTSTDNSKAATENVP
LSLPIKIPAGALQEIVRQPPLPSGMDTMDFGAAQEQAASAPRVLAFLRDVEITSASTTS
VRVFLGKNDLKADTPVTDPHYVGSFAVLGHDGDHHRKPSFVLDLTDAIQRVYGGRGQTD
GEAIDLQLIPVGSGAGKPGAVEPAKLEIAIVSA"
protein_bind complement(1891..1907)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1915..1944)
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
CDS complement(2179..3258)
/label=lacI
/note="lac repressor"
promoter complement(3259..3336)
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
misc_feature 3522..3662
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(3848..4436)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4610..5467)
/label=AmpR
/note="beta-lactamase"
promoter complement(5468..5559)
/label=AmpR promoter
terminator complement(5579..5606)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(5698..5784)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.