Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | pTrc-TrxTAL | Antibiotic Resistance | Ampicillin |
Length | 6022 bp | Type | Cloning vector |
Source | Kim B, Binkley R, Kim HU, Lee SY. |
pTrc-TrxTAL vector Vector Map
Plasmid Resuspension protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTrc-TrxTAL vector Sequence
LOCUS Exported 6022 bp ds-DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTrc-TrxTAL, complete sequence. ACCESSION MH488931 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6022) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 6022) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 6022) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6022 /organism="Cloning vector pTrc-TrxTAL" /lab_host="Escherichia coli" /mol_type="other DNA" /db_xref="taxon:2301175" regulatory 193..246 /regulatory_class="promoter" /note="Trc promoter" promoter 193..222 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 230..246 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." 5'UTR 247..271 /gene="TAL" gene 247..271 /gene="TAL" /label=TAL misc_feature 272..598 /gene="trxA" /note="similar to thioredoxin; derived from Escherichia coli; N-terminal thioredoxin-tag" gene 272..598 /gene="trxA" /label=trxA CDS 272..595 /codon_start=1 /gene="trxA" /product="E. coli thioredoxin" /label=TrxA /translation="MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDE IADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFL DANL" misc_feature 599..2128 /gene="TAL" /note="similar to tyrosine ammonia-lyase; derived from Saccharothrix espanaensis" gene 599..2128 /gene="TAL" /label=TAL regulatory 2255..2580 /regulatory_class="terminator" /note="rrnBT1T2" terminator 2375..2461 /gene="Escherichia coli rrnB" /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2553..2580 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2600..2691 /gene="bla" /label=AmpR promoter CDS 2692..3552 /codon_start=1 /gene="bla" /product="beta-lactamase" /label=bla /protein_id="AXN70022.1" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" gene 2692..3552 /gene="bla" /label=bla rep_origin 3707..4326 /label=pBR322 /note="pBR322" rep_origin 3723..4311 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 4497..4637 /label=bom /note="basis of mobility region from pBR322" promoter 4823..4900 /gene="lacI (mutant)" /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 4892..5983 /codon_start=1 /gene="lacIq" /product="lac repressor protein" /label=lacIq /protein_id="AXN70023.1" /translation="MVNVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM AELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVER SGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTED SSCYIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTA SPRALADSLMQLARQVSRLESGQ" gene 4892..5983 /gene="lacIq" /label=lacIq CDS 4901..5983 /codon_start=1 /gene="lacI" /product="lac repressor" /label=lacI /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ"
This page is informational only.