Basic Vector Information
- Vector Name:
- pTrc-SeTAL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5698 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
pTrc-SeTAL vector Map
pTrc-SeTAL vector Sequence
LOCUS 40924_43913 5698 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pTrc-SeTAL, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5698)
AUTHORS Kim B, Binkley R, Kim HU, Lee SY.
TITLE Metabolic engineering of Escherichia coli for the enhanced
production of l-tyrosine
JOURNAL Biotechnol. Bioeng. (2018) In press
PUBMED 30019750
REFERENCE 2 (bases 1 to 5698)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Direct Submission
JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering,
Korea Advanced Institute of Science and Technology, Daehak-ro 291,
Daejeon 34141, South Korea
REFERENCE 3 (bases 1 to 5698)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5698)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
Bioeng. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea
Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
34141, South Korea"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5698
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 193..222
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 230..246
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
5'UTR 247..271
/gene="TAL"
gene 247..271
/gene="TAL"
/label=TAL
CDS 272..1804
/codon_start=1
/gene="TAL"
/product="tyrosine ammonia-lyase"
/label=TAL
/note="derived from Saccharothrix espanaensis"
/protein_id="AXN70016.1"
/translation="MTQVVERQADRLSSREYLARVVRSAGWDAGLTSCTDEEIVRMGAS
ARTIEEYLKSDKPIYGLTQGFGPLVLFDADSELEQGGSLISHLGTGQGAPLAPEVSRLI
LWLRIQNMRKGYSAVSPVFWQKLADLWNKGFTPAIPRHGTVSASGDLQPLAHAALAFTG
VGEAWTRDADGRWSTVPAVDALAALGAEPFDWPVREALAFVNGTGASLAVAVLNHRSAL
RLVRACAVLSARLATLLGANPEHYDVGHGVARGQVGQLTAAEWIRQGLPRGMVRDGSRP
LQEPYSLRCAPQVLGAVLDQLDGAGDVLAREVDGCQDNPITYEGELLHGGNFHAMPVGF
ASDQIGLAMHMAAYLAERQLGLLVSPVTNGDLPPMLTPRAGRGAGLAGVQISATSFVSR
IRQLVFPASLTTLPTNGWNQDHVPMALNGANSVFEALELGWLTVGSLAVGVAQLAAMTG
HAAEGVWAELAGICPPLDADRPLGAEVRAARDLLSAHADQLLVDEADGKDFG"
gene 272..1804
/gene="TAL"
/label=TAL
terminator 2051..2137
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 2229..2256
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 2276..2367
/label=AmpR promoter
CDS 2368..3225
/label=AmpR
/note="beta-lactamase"
rep_origin 3399..3987
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(4173..4313)
/label=bom
/note="basis of mobility region from pBR322"
promoter 4499..4576
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 4577..5656
/label=lacI
/note="lac repressor"
This page is informational only.