Basic Vector Information
pTrc-SeTAL vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTrc-SeTAL vector Sequence
LOCUS 40924_43913 5698 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTrc-SeTAL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5698) AUTHORS Kim B, Binkley R, Kim HU, Lee SY. TITLE Metabolic engineering of Escherichia coli for the enhanced production of l-tyrosine JOURNAL Biotechnol. Bioeng. (2018) In press PUBMED 30019750 REFERENCE 2 (bases 1 to 5698) AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY. TITLE Direct Submission JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea REFERENCE 3 (bases 1 to 5698) TITLE Direct Submission REFERENCE 4 (bases 1 to 5698) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng. (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon 34141, South Korea" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5698 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 193..222 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 230..246 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." 5'UTR 247..271 /gene="TAL" gene 247..271 /gene="TAL" /label=TAL CDS 272..1804 /codon_start=1 /gene="TAL" /product="tyrosine ammonia-lyase" /label=TAL /note="derived from Saccharothrix espanaensis" /protein_id="AXN70016.1" /translation="MTQVVERQADRLSSREYLARVVRSAGWDAGLTSCTDEEIVRMGAS ARTIEEYLKSDKPIYGLTQGFGPLVLFDADSELEQGGSLISHLGTGQGAPLAPEVSRLI LWLRIQNMRKGYSAVSPVFWQKLADLWNKGFTPAIPRHGTVSASGDLQPLAHAALAFTG VGEAWTRDADGRWSTVPAVDALAALGAEPFDWPVREALAFVNGTGASLAVAVLNHRSAL RLVRACAVLSARLATLLGANPEHYDVGHGVARGQVGQLTAAEWIRQGLPRGMVRDGSRP LQEPYSLRCAPQVLGAVLDQLDGAGDVLAREVDGCQDNPITYEGELLHGGNFHAMPVGF ASDQIGLAMHMAAYLAERQLGLLVSPVTNGDLPPMLTPRAGRGAGLAGVQISATSFVSR IRQLVFPASLTTLPTNGWNQDHVPMALNGANSVFEALELGWLTVGSLAVGVAQLAAMTG HAAEGVWAELAGICPPLDADRPLGAEVRAARDLLSAHADQLLVDEADGKDFG" gene 272..1804 /gene="TAL" /label=TAL terminator 2051..2137 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2229..2256 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2276..2367 /label=AmpR promoter CDS 2368..3225 /label=AmpR /note="beta-lactamase" rep_origin 3399..3987 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4173..4313) /label=bom /note="basis of mobility region from pBR322" promoter 4499..4576 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 4577..5656 /label=lacI /note="lac repressor"
This page is informational only.