pTrc-SeTAL vector (V002547)

Basic Vector Information

      • Vector Name:
      • pTrc-SeTAL
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 5698 bp
      • Type:
      • Cloning vector
      • Replication origin:
      • ori
      • Source/Author:
      • Kim B, Binkley R, Kim HU, Lee SY.

pTrc-SeTAL vector Vector Map

pTrc-SeTAL5698 bp60012001800240030003600420048005400trc promoterlac operator5'UTRTALrrnB T1 terminatorrrnB T2 terminatorAmpR promoterAmpRoribomlacIq promoterlacI

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pTrc-SeTAL vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_43913        5698 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTrc-SeTAL, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5698)
  AUTHORS   Kim B, Binkley R, Kim HU, Lee SY.
  TITLE     Metabolic engineering of Escherichia coli for the enhanced 
            production of l-tyrosine
  JOURNAL   Biotechnol. Bioeng. (2018) In press
  PUBMED    30019750
REFERENCE   2  (bases 1 to 5698)
  AUTHORS   Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering,
            Korea Advanced Institute of Science and Technology, Daehak-ro 291, 
            Daejeon 34141, South Korea
REFERENCE   3  (bases 1 to 5698)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5698)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
            Bioeng. (2018) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea 
            Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
            34141, South Korea"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5698
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        193..222
                     /label=trc promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    230..246
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     5'UTR           247..271
                     /gene="TAL"
     gene            247..271
                     /gene="TAL"
                     /label=TAL
     CDS             272..1804
                     /codon_start=1
                     /gene="TAL"
                     /product="tyrosine ammonia-lyase"
                     /label=TAL
                     /note="derived from Saccharothrix espanaensis"
                     /protein_id="AXN70016.1"
                     /translation="MTQVVERQADRLSSREYLARVVRSAGWDAGLTSCTDEEIVRMGAS
                     ARTIEEYLKSDKPIYGLTQGFGPLVLFDADSELEQGGSLISHLGTGQGAPLAPEVSRLI
                     LWLRIQNMRKGYSAVSPVFWQKLADLWNKGFTPAIPRHGTVSASGDLQPLAHAALAFTG
                     VGEAWTRDADGRWSTVPAVDALAALGAEPFDWPVREALAFVNGTGASLAVAVLNHRSAL
                     RLVRACAVLSARLATLLGANPEHYDVGHGVARGQVGQLTAAEWIRQGLPRGMVRDGSRP
                     LQEPYSLRCAPQVLGAVLDQLDGAGDVLAREVDGCQDNPITYEGELLHGGNFHAMPVGF
                     ASDQIGLAMHMAAYLAERQLGLLVSPVTNGDLPPMLTPRAGRGAGLAGVQISATSFVSR
                     IRQLVFPASLTTLPTNGWNQDHVPMALNGANSVFEALELGWLTVGSLAVGVAQLAAMTG
                     HAAEGVWAELAGICPPLDADRPLGAEVRAARDLLSAHADQLLVDEADGKDFG"
     gene            272..1804
                     /gene="TAL"
                     /label=TAL
     terminator      2051..2137
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2229..2256
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        2276..2367
                     /label=AmpR promoter
     CDS             2368..3225
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      3399..3987
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(4173..4313)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     promoter        4499..4576
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     CDS             4577..5656
                     /label=lacI
                     /note="lac repressor"

This page is informational only.