pTPTK2 vector (V002562)

LOCUS       V002562                 5455 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002562
VERSION     V002562
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5455)
  AUTHORS   Catchpole R, Gorlas A, Oberto J, Forterre P.
  TITLE     A series of new E. coli-Thermococcus shuttle vectors compatible with
            previously existing vectors
  JOURNAL   Extremophiles (2018) In press
   PUBMED   29497842
REFERENCE   2  (bases 1 to 5455)
  AUTHORS   Catchpole R, Gorlas A, Oberto J, Forterre P.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du
            Dr Roux, Paris 75015, France
REFERENCE   3  (bases 1 to 5455)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5455)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Extremophiles (2018) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (05-FEB-2018) Microbiology, Institut Pasteur, 25-28 Rue du Dr Roux,
            Paris 75015, France"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5455
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(268..813)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             1253..2551
                     /gene="trpE"
                     /label="Anthranilate synthase component 1"
                     /note="Anthranilate synthase component 1 from Thermococcus
                     kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1).
                     Accession#: Q9YGB3"
     CDS             complement(2582..2716)
                     /codon_start=1
                     /product="transmembrane domain protein"
                     /label="transmembrane domain protein"
                     /protein_id="AVP12436.1"
                     /translation="MSKKLDVKVKVNIYVNVHIDIKVAISIAVTIAVIALLKVLLNIR"
     CDS             2819..2968
                     /codon_start=1
                     /product="SpoVT/AbrB-like transcriptional regulator"
                     /label="SpoVT/AbrB-like transcriptional regulator"
                     /note="swapped-hairpin fold CDS"
                     /protein_id="AVP12435.1"
                     /translation="MQDVRKMFRSGSSYVVAFPPSVIQKTKFRHQRTVRVRIYDDKIVI
                     VPLW"
     CDS             3631..4389
                     /codon_start=1
                     /product="RepTP2"
                     /label="RepTP2"
                     /protein_id="AVP12434.1"
                     /translation="MTLMCLWFHTRTRFTSRAMLVQKLERYDSLFKVASARHTDAVFLT
                     LTTDPSRFSNLYEANRQFSHSFNRFMSRLRGYFARRGQHLEYIAVYEFTKSGLLHAHVI
                     IFGVRYLLPVRVISRWWSEAGQGRVVYIYRLRNVDGRWVWARRRPRDVRAGEGAEDYLK
                     KYLRKALRLASTLDTSDVKKVLPLALYWAFNKRFFTYSRSLLPSSRRTAEAVVSEYLWV
                     GTYRLEDLPDWVFWLPHRVYSPPSRGPPPT"
     CDS             complement(4438..5094)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(5095..5197)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"