pTNS3-asdEc vector (V002575)

LOCUS       V002575                10251 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002575
VERSION     V002575
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10251)
  AUTHORS   Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT.
  TITLE     Engineering of tellurite-resistant genetic tools for single-copy
            chromosomal analysis of Burkholderia spp. and characterization of
            the Burkholderia thailandensis betBA operon
  JOURNAL   Appl. Environ. Microbiol. 75 (12), 4015-4027 (2009)
   PUBMED   19376905
REFERENCE   2  (bases 1 to 10251)
  AUTHORS   Kang Y, Norris MH, Barrett AR, Wilcox BA, Hoang TT.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2009) Molecular Biosciences and Bioengineering,
            University of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207,
            Honolulu, HI 96822, USA
REFERENCE   3  (bases 1 to 10251)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10251)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2009"; volume: "75"; issue: "12";
            pages: "4015-4027"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-MAR-2009) Molecular Biosciences and Bioengineering, University
            of Hawaii at Manoa, 2538 McCarthy Mall, Snyder Hall 207, Honolulu,
            HI 96822, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10251
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(600..984)
                     /direction=LEFT
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     oriT            complement(1007..1115)
                     /direction=LEFT
                     /label="oriT"
                     /note="incP origin of transfer"
     protein_bind    1491..1512
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1527..1557
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    1565..1581
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     1589..1605
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        1642..1670
                     /label="Pc promoter"
                     /note="class 1 integron promoter"
     mobile_element  complement(2181..2405)
                     /label="Tn7R"
                     /note="mini-Tn7 element (right end of the Tn7 transposon)"
     CDS             3123..5228
                     /gene="tnsB"
                     /label="Transposon Tn7 transposition protein TnsB"
                     /note="Transposon Tn7 transposition protein TnsB from
                     Escherichia coli. Accession#: P13989"
     CDS             5228..6892
                     /gene="tnsC"
                     /label="Transposon Tn7 transposition protein TnsC"
                     /note="Transposon Tn7 transposition protein TnsC from
                     Escherichia coli. Accession#: P05846"
     CDS             6898..8424
                     /codon_start=1
                     /gene="tnsD"
                     /product="TnsD"
                     /label="tnsD"
                     /note="Tn7 transposase subunit"
                     /protein_id="ACN91051.1"
                     /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT
                     LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV
                     HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR
                     AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY
                     QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA
                     FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ
                     LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA
                     VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY
                     QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE"
     gene            6898..8424
                     /gene="tnsD"
                     /label="tnsD"
     primer_bind     complement(8719..8735)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             9072..10172
                     /gene="asd"
                     /label="Aspartate-semialdehyde dehydrogenase"
                     /note="Aspartate-semialdehyde dehydrogenase from
                     Escherichia coli O157:H7. Accession#: P0A9R0"